Product Number |
ARP40927_T100 |
Product Page |
www.avivasysbio.com/dazap1-antibody-c-terminal-region-arp40927-t100.html |
Name |
DAZAP1 Antibody - C-terminal region (ARP40927_T100) |
Protein Size (# AA) |
407 amino acids |
Molecular Weight |
45kDa |
NCBI Gene Id |
26528 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
DAZ associated protein 1 |
Peptide Sequence |
Synthetic peptide located within the following region: GFGQGFSDPSQQPPSYGGPSVPGSGGPPAGGSGFGRGQNHNVQGFHPYRR |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Pan,H.A., Fertil. Steril. 84 SUPPL 2, 1089-1094 (2005) |
Description of Target |
In mammals, the Y chromosome directs the development of the testes and plays an important role in spermatogenesis. A high percentage of infertile men have deletions that map to regions of the Y chromosome. The DAZ (deleted in azoospermia) gene cluster maps to the AZFc region of the Y chromosome and is deleted in many azoospermic and severely oligospermic men. It is thought that the DAZ gene cluster arose from the transposition, amplification, and pruning of the ancestral autosomal gene DAZL also involved in germ cell development and gametogenesis. DAZAP1 is a RNA-binding protein with two RNP motifs that was originally identified by its interaction with the infertility factors DAZ and DAZL.In mammals, the Y chromosome directs the development of the testes and plays an important role in spermatogenesis. A high percentage of infertile men have deletions that map to regions of the Y chromosome. The DAZ (deleted in azoospermia) gene cluster maps to the AZFc region of the Y chromosome and is deleted in many azoospermic and severely oligospermic men. It is thought that the DAZ gene cluster arose from the transposition, amplification, and pruning of the ancestral autosomal gene DAZL also involved in germ cell development and gametogenesis. This gene encodes a RNA-binding protein with two RNP motifs that was originally identified by its interaction with the infertility factors DAZ and DAZL. Two isoforms are encoded by transcript variants of this gene.In mammals, the Y chromosome directs the development of the testes and plays an important role in spermatogenesis. A high percentage of infertile men have deletions that map to regions of the Y chromosome. The DAZ (deleted in azoospermia) gene cluster maps to the AZFc region of the Y chromosome and is deleted in many azoospermic and severely oligospermic men. It is thought that the DAZ gene cluster arose from the transposition, amplification, and pruning of the ancestral autosomal gene DAZL also involved in germ cell development and gametogenesis. This gene encodes a RNA-binding protein with two RNP motifs that was originally identified by its interaction with the infertility factors DAZ and DAZL. Two isoforms are encoded by transcript variants of this gene. |
Protein Interactions |
UBC; WWOX; RPA3; RPA2; RPA1; SUZ12; RNF2; EZH2; BMI1; rev; ITCH; RAD52; VCAM1; ITGA4; FN1; BRCA1; CAND1; COPS5; CUL1; CUL2; CUL3; CUL4B; CUL5; NEDD8; ELAVL1; SUMO2; DAZ1; DAZL; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-DAZAP1 (ARP40927_T100) antibody |
Blocking Peptide |
For anti-DAZAP1 (ARP40927_T100) antibody is Catalog # AAP40927 (Previous Catalog # AAPP22895) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human DAZAP1 |
Uniprot ID |
Q96EP5 |
Protein Name |
DAZ-associated protein 1 |
Sample Type Confirmation |
DAZAP1 is supported by BioGPS gene expression data to be expressed in Daudi |
Protein Accession # |
NP_061832 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_018959 |
Tested Species Reactivity |
Human |
Gene Symbol |
DAZAP1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 100% |
Image 1 | Human Liver
| Rabbit Anti-DAZAP1 Antibody Catalog Number: ARP40927 Paraffin Embedded Tissue: Human Liver Cellular Data: Hepatocytes Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X |
|
Image 2 | Human Heart
| Rabbit Anti-DAZAP1 Antibody Catalog Number: ARP40927 Paraffin Embedded Tissue: Human Heart Cellular Data: Myocardial cells Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X |
|
Image 3 | Human Daudi
| WB Suggested Anti-DAZAP1 Antibody Titration: 1.25ug/ml Positive Control: Daudi cell lysateDAZAP1 is supported by BioGPS gene expression data to be expressed in Daudi |
|
Image 4 | Human Heart
| Rabbit Anti-DAZAP1 antibody
Catalog Number: ARP40927
Paraffin Embedded Tissue: Human Heart
cell Cellular Data: cardiac cell
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X |
|