KLHDC8A Antibody - C-terminal region (ARP40902_T100)

• Product Number: ARP40902_T100
• Name: KLHDC8A Antibody - C-terminal region (ARP40902_T100)
• Protein Size (# AA): 350 amino acids
• Molecular Weight: 39kDa
• NCBI Gene Id: 55220
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Kelch domain containing 8A
• Peptide Sequence: Synthetic peptide located within the following region: PGKNKWEILPAMPTPRCACSSIVVKNCLLAVGGVNQGLSDAVEALCVSDS
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Ota,T., (2004) Nat. Genet. 36 (1), 40-45
• Description of Target: The function remains unknown.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-KLHDC8A (ARP40902_T100) antibody is Catalog # AAP40902 (Previous Catalog # AAPP10630)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human KLHDC8A
• Uniprot ID: Q8IYD2
• Protein Name: Kelch domain-containing protein 8A
• Protein Accession #: NP_060673
• Purification: Protein A purified
• Nucleotide Accession #: NM_018203
• Tested Species Reactivity: Human
• Gene Symbol: KLHDC8A
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%
• Image 1: Human Jurkat
  
  WB Suggested Anti-KLHDC8A Antibody Titration: 1.25ug/ml
  Positive Control: Jurkat cell lysate
• Image 2: Human Lung
  
  Rabbit Anti-KLHDC8A antibody
  Catalog Number: ARP40902
  Paraffin Embedded Tissue: Human Lung
  cell Cellular Data: bronchiole epithelium
  Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X