RBM22 Antibody - C-terminal region (ARP40889_P050)

Data Sheet
 
Product Number ARP40889_P050
Product Page www.avivasysbio.com/rbm22-antibody-c-terminal-region-arp40889-p050.html
Name RBM22 Antibody - C-terminal region (ARP40889_P050)
Protein Size (# AA) 420 amino acids
Molecular Weight 46kDa
NCBI Gene Id 55696
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name RNA binding motif protein 22
Alias Symbols Cwc2, ZC3H16, fSAP47
Peptide Sequence Synthetic peptide located within the following region: KWGRSQAARGKEKEKDGTTDSGIKLEPVPGLPGALPPPPAAEEEASANYF
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Isogai,T. Unpublished (2000)
Description of Target RBM22 may be involved in pre-mRNA splicing.
Protein Interactions CEP55; UBC; SUZ12; HDAC11; RBM4; RBFOX2; HNRNPUL1; AQR; EIF4A3; MAGOH; BARD1; CUL3; PRNP; RNU6-1; RNU6-6P; RNU6-50P;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-RBM22 (ARP40889_P050) antibody
Blocking Peptide For anti-RBM22 (ARP40889_P050) antibody is Catalog # AAP40889 (Previous Catalog # AAPP22867)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human RBM22
Uniprot ID Q9NW64
Protein Name Pre-mRNA-splicing factor RBM22
Protein Accession # NP_060517
Purification Affinity Purified
Nucleotide Accession # NM_018047
Tested Species Reactivity Human
Gene Symbol RBM22
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Image 1
Human Heart
Rabbit Anti-RBM22 Antibody
Catalog Number: ARP40889
Paraffin Embedded Tissue: Human Heart
Cellular Data: Myocardial cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
Image 2
Human Muscle
Rabbit Anti-RBM22 Antibody
Catalog Number: ARP40889
Paraffin Embedded Tissue: Human Muscle
Cellular Data: Skeletal muscle cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
Image 3
Human Jurkat
WB Suggested Anti-RBM22 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com