Product Number |
ARP40869_T100 |
Product Page |
www.avivasysbio.com/carf-antibody-c-terminal-region-arp40869-t100.html |
Name |
CARF Antibody - C-terminal region (ARP40869_T100) |
Protein Size (# AA) |
580 amino acids |
Molecular Weight |
64kDa |
NCBI Gene Id |
55602 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
CDKN2A interacting protein |
Alias Symbols |
CARF |
Peptide Sequence |
Synthetic peptide located within the following region: AIEALKATLDVFFVPLKELADLPQNKSSQESIVCELRCKSVYLGTGCGKS |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Hasan,M.K., (2002) J. Biol. Chem. 277 (40), 37765-37770 |
Description of Target |
CARF was first cloned as a novel binding partner of ARF from a yeast-interactive screen. CARF and ARF colocalize in the perinucleolar region and have a collaborative function. In the nucleoplasm, CARF interacts with p53 and enhances its function. The p53 downregulates CARF in a negative feedback regulatory loop and may also involve p53 antagonist HDM2. |
Protein Interactions |
UBC; XRN2; RPA3; RPA2; RPA1; WHSC1; VCP; Cdkn2a; MDC1; BRCA1; BARD1; GGH; EPHX1; MDM2; CUL3; SUMO2; RAD21; DHX58; Clp1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-CDKN2AIP (ARP40869_T100) antibody |
Blocking Peptide |
For anti-CDKN2AIP (ARP40869_T100) antibody is Catalog # AAP40869 (Previous Catalog # AAPY01104) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human CARF |
Uniprot ID |
Q9NXV6 |
Protein Name |
CDKN2A-interacting protein |
Sample Type Confirmation |
CDKN2AIP is supported by BioGPS gene expression data to be expressed in Jurkat |
Protein Accession # |
NP_060102 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_017632 |
Tested Species Reactivity |
Human |
Gene Symbol |
CDKN2AIP |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
WB, IHC |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
Image 1 | Human Jurkat
| WB Suggested Anti-CARF Antibody Titration: 0.3125ug/ml Positive Control: Jurkat cell lysateCDKN2AIP is supported by BioGPS gene expression data to be expressed in Jurkat |
|