CARF Antibody - C-terminal region (ARP40869_T100)

Data Sheet
 
Product Number ARP40869_T100
Product Page www.avivasysbio.com/carf-antibody-c-terminal-region-arp40869-t100.html
Name CARF Antibody - C-terminal region (ARP40869_T100)
Protein Size (# AA) 580 amino acids
Molecular Weight 64kDa
NCBI Gene Id 55602
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name CDKN2A interacting protein
Alias Symbols CARF
Peptide Sequence Synthetic peptide located within the following region: AIEALKATLDVFFVPLKELADLPQNKSSQESIVCELRCKSVYLGTGCGKS
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Hasan,M.K., (2002) J. Biol. Chem. 277 (40), 37765-37770
Description of Target CARF was first cloned as a novel binding partner of ARF from a yeast-interactive screen. CARF and ARF colocalize in the perinucleolar region and have a collaborative function. In the nucleoplasm, CARF interacts with p53 and enhances its function. The p53 downregulates CARF in a negative feedback regulatory loop and may also involve p53 antagonist HDM2.
Protein Interactions UBC; XRN2; RPA3; RPA2; RPA1; WHSC1; VCP; Cdkn2a; MDC1; BRCA1; BARD1; GGH; EPHX1; MDM2; CUL3; SUMO2; RAD21; DHX58; Clp1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CDKN2AIP (ARP40869_T100) antibody
Blocking Peptide For anti-CDKN2AIP (ARP40869_T100) antibody is Catalog # AAP40869 (Previous Catalog # AAPY01104)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human CARF
Uniprot ID Q9NXV6
Protein Name CDKN2A-interacting protein
Sample Type Confirmation

CDKN2AIP is supported by BioGPS gene expression data to be expressed in Jurkat

Protein Accession # NP_060102
Purification Protein A purified
Nucleotide Accession # NM_017632
Tested Species Reactivity Human
Gene Symbol CDKN2AIP
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB, IHC
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Image 1
Human Jurkat
WB Suggested Anti-CARF Antibody Titration: 0.3125ug/ml
Positive Control: Jurkat cell lysateCDKN2AIP is supported by BioGPS gene expression data to be expressed in Jurkat
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com