LARP7 Antibody - C-terminal region (ARP40848_T100)

Data Sheet
 
Product Number ARP40848_T100
Product Page www.avivasysbio.com/larp7-antibody-c-terminal-region-arp40848-t100.html
Name LARP7 Antibody - C-terminal region (ARP40848_T100)
Protein Size (# AA) 355 amino acids
Molecular Weight 39kDa
NCBI Gene Id 51574
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name La ribonucleoprotein domain family, member 7
Alias Symbols ALAZS, PIP7S, hLARP7, HDCMA18P
Peptide Sequence Synthetic peptide located within the following region: HCWKLEILSGDHEQRYWQKILVDRQAKLNQPREKKRGTEKLITKAEKIRL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Brandenberger R, (2004) Nat Biotechnol. 2004 Jun;22(6):707-16. Epub 2004 May 16.
Description of Target The function remains unknown.
Protein Interactions HEXIM1; AFF1; CDK9; CCNT1; UBC; LIN28B; LIN28A; MEPCE; RNF2; VCPIP1; RABEP2; BRCC3; RPP25; CD2AP; JMJD6; HNRNPR; TRIM28; HUWE1; MTA2; SPAG9; TSC22D1; HDAC1; NR3C1; RN7SK; RPS16; HNRNPA1; CSNK2A1; tat; PAXIP1; BARD1; APP; CAND1; SIRT7; PRPF40A; Ybx1; Nhp2l
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-LARP7 (ARP40848_T100) antibody
Blocking Peptide For anti-LARP7 (ARP40848_T100) antibody is Catalog # AAP40848 (Previous Catalog # AAPY01100)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human LARP7
Uniprot ID Q4G0J3
Protein Name La-related protein 7
Sample Type Confirmation

LARP7 is supported by BioGPS gene expression data to be expressed in Jurkat

Protein Accession # EAX06285
Purification Protein A purified
Nucleotide Accession # NM_001267039
Tested Species Reactivity Human
Gene Symbol LARP7
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Image 1
Human Jurkat
WB Suggested Anti-LARP7 Antibody Titration: 1.25ug/ml
Positive Control: Jurkat cell lysateLARP7 is supported by BioGPS gene expression data to be expressed in Jurkat
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com