HSD17B11 Antibody - N-terminal region (ARP40843_P050)

• Product Number: ARP40843_P050
• Name: HSD17B11 Antibody - N-terminal region (ARP40843_P050)
• Protein Size (# AA): 300 amino acids
• Molecular Weight: 33kDa
• NCBI Gene Id: 51170
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Hydroxysteroid (17-beta) dehydrogenase 11
• Alias Symbols: DHRS8, PAN1B, RETSDR2, SDR16C2, 17BHSD11, 17-BETA-HSD11, 17-BETA-HSDXI
• Peptide Sequence: Synthetic peptide located within the following region: TGEIVLITGAGHGIGRLTAYEFAKLKSKLVLWDINKHGLEETAAKCKGLG
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: Short-chain alcohol dehydrogenases, such as HSD17B11, metabolize secondary alcohols and ketones (Brereton et al., 2001 [PubMed 11165019]).
• Protein Interactions: FBXO6; UBD; UBC; ELAVL1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-HSD17B11 (ARP40843_P050) antibody is Catalog # AAP40843 (Previous Catalog # AAPY01095)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HSD17B11
• Uniprot ID: Q8NBQ5
• Protein Name: Estradiol 17-beta-dehydrogenase 11
• Protein Accession #: NP_057329
• Purification: Affinity Purified
• Nucleotide Accession #: NM_016245
• Tested Species Reactivity: Monkey
• Gene Symbol: HSD17B11
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Monkey
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 100%; Guinea Pig: 92%; Horse: 93%; Human: 100%; Mouse: 92%; Rabbit: 93%; Rat: 92%
• Image 1: Monkey adrenal gland
  
  Sample Type:
  Monkey adrenal gland
  Primary Antibody Dilution:
  1:25
  Secondary Antibody:
  Anti-rabbit-HRP
  Secondary Antibody Dilution:
  1:1000
  Color/Signal Descriptions:
  Brown: HSD17B11 Blue: Nucleus
  Gene Name:
  HSD17B11
  Submitted by:
  Jonathan Bertin, Endoceutics Inc.
• Image 2: Monkey vagina
  
  Sample Type:
  Monkey vagina
  Primary Antibody Dilution:
  1:25
  Secondary Antibody:
  Anti-rabbit-HRP
  Secondary Antibody Dilution:
  1:1000
  Color/Signal Descriptions:
  Brown: HSD17B11 Blue: Nucleus
  Gene Name:
  HSD17B11
  Submitted by:
  Jonathan Bertin, Endoceutics Inc.