website statistics
Product Datasheet: ARP40841_T100 - CPSF3 antibody - C-terminal region (ARP40841_T100) - Aviva Systems Biology
 
CPSF3 antibody - C-terminal region (ARP40841_T100)
Data Sheet
 
Product Number ARP40841_T100
Product Page www.avivasysbio.com/cpsf3-antibody-c-terminal-region-arp40841-t100.html
Product Name CPSF3 antibody - C-terminal region (ARP40841_T100)
Size 100 ul
Gene Symbol CPSF3
Alias Symbols CPSF, YSH1, CPSF73, CPSF-73
Protein Size (# AA) 684 amino acids
Molecular Weight 75kDa
Subunit 3
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 51692
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Cleavage and polyadenylation specific factor 3, 73kDa
Description This is a rabbit polyclonal antibody against CPSF3. It was validated on Western Blot and immunohistochemistry by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (info@avivasysbio.com).
Peptide Sequence Synthetic peptide located within the following region: DDSILSVTVDGKTANLNLETRTVECEEGSEDDESLREMVELAAQRLYEAL
Target Reference Calzado,M.A., (2004) J. Virol. 78 (13), 6846-6854
Description of Target CPSF3 belongs to the RNA-metabolizing metallo-beta-lactamase-like family, CPSF3 subfamily. It is component of the cleavage and polyadenylation specificity factor (CPSF) complex that play a key role in pre-mRNA 3'-end formation, recognizing the AAUAAA signal sequence and interacting with poly(A) polymerase and other factors to bring about cleavage and poly(A) addition.
Protein Interactions UBC; SUMO1; WWOX; AICDA; POLR2A; NPM1; TUT1; SYMPK; CSTF2; CPSF2; PAXIP1; MDC1; BARD1; FIP1L1; POLR1E; WDR33; CPSF1; UBD; SIRT7; SMARCAD1; RRAGA; TBP; CDC73; CLP1; PAPOLA; YWHAG;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-CPSF3 (ARP40841_T100) antibody is Catalog # AAP40841 (Previous Catalog # AAPS01709)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human CPSF3
Complete computational species homology data Anti-CPSF3 (ARP40841_T100)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express CPSF3.
Swissprot Id Q9UKF6
Protein Name Cleavage and polyadenylation specificity factor subunit 3
Protein Accession # NP_057291
Purification Protein A purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express CPSF3.
Nucleotide Accession # NM_016207
Replacement Item This antibody may replace item sc-26661 from Santa Cruz Biotechnology.
Conjugation Options

ARP40841_T100-FITC Conjugated

ARP40841_T100-HRP Conjugated

ARP40841_T100-Biotin Conjugated

CB Replacement sc-26661; sc-292505; sc-393001
Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 86%; Rat: 93%
Image 1
Human Jurkat
WB Suggested Anti-CPSF3 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate
Image 2
Human Liver
Rabbit Anti-CPSF3 Antibody
Catalog Number: ARP40841
Paraffin Embedded Tissue: Human Liver
Cellular Data: Liver cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com