| Product Number |
ARP40832_P050 |
| Product Page |
www.avivasysbio.com/nip7-antibody-middle-region-arp40832-p050.html |
| Name |
NIP7 Antibody - middle region (ARP40832_P050) |
| Protein Size (# AA) |
180 amino acids |
| Molecular Weight |
20kDa |
| Subunit |
biogenesis protein NIP7 homolog |
| NCBI Gene Id |
51388 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Nuclear import 7 homolog (S. cerevisiae) |
| Alias Symbols |
KD93, CGI-37, HSPC031 |
| Peptide Sequence |
Synthetic peptide located within the following region: PGAEQSFLYGNHVLKSGLGRITENTSQYQGVVVYSMADIPLGFGVAAKST |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Oh,J.H., (2005) Mamm. Genome 16 (12), 942-954 |
| Description of Target |
NIP7 contains 1PUA domain and belongs to the NIP7 family. It may play a role in 60S ribosomal subunit synthesis. |
| Protein Interactions |
LZTS2; NECAB2; NIP7; CRX; SOX2; UBC; ELAVL1; NOL8; ZBED1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-NIP7 (ARP40832_P050) antibody |
| Blocking Peptide |
For anti-NIP7 (ARP40832_P050) antibody is Catalog # AAP40832 (Previous Catalog # AAPY01084) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human NIP7 |
| Uniprot ID |
Q9Y221 |
| Protein Name |
60S ribosome subunit biogenesis protein NIP7 homolog |
| Sample Type Confirmation |
NIP7 is supported by BioGPS gene expression data to be expressed in SW620 |
| Protein Accession # |
NP_057185 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_016101 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
NIP7 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 86% |
| Image 1 | Human SW620
 | WB Suggested Anti-NIP7 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: SW620 cell lysateNIP7 is supported by BioGPS gene expression data to be expressed in SW620 |
|
| Image 2 | Human Lung
 | Rabbit Anti-NIP7 antibody
Catalog Number: ARP40832
Paraffin Embedded Tissue: Human Lung cell Cellular Data: alveolar cell of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X |
|
