CSTF2T Antibody - C-terminal region (ARP40808_P050)

• Product Number: ARP40808_P050
• Name: CSTF2T Antibody - C-terminal region (ARP40808_P050)
• Protein Size (# AA): 616 amino acids
• Molecular Weight: 64kDa
• Subunit: 2 tau variant
• NCBI Gene Id: 23283
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa, tau variant
• Alias Symbols: CstF-64T
• Peptide Sequence: Synthetic peptide located within the following region: AGIQGGGMQGAGIQGVSIQGGGIQGGGIQGASKQGGSQPSSFSPGQSQVT
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Zhao,X., (2005) J. Virol. 79 (7), 4270-4288
• Description of Target: CSTF2T may play a significant role in AAUAAA-independent mRNA polyadenylation in germ cells. It is directly involved in the binding to pre-mRNAs.
• Protein Interactions: UBQLN1; HGS; UBC; CSTF3; UBQLN4; CPSF1; CPSF2; CPSF4; RRAGA;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-CSTF2T (ARP40808_P050) antibody is Catalog # AAPY01060
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CSTF2T
• Uniprot ID: Q9H0L4
• Protein Name: Cleavage stimulation factor subunit 2 tau variant
• Protein Accession #: NP_056050
• Purification: Affinity Purified
• Nucleotide Accession #: NM_015235
• Tested Species Reactivity: Human
• Gene Symbol: CSTF2T
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 86%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 93%; Rabbit: 79%; Rat: 86%
• Image 1: Human HepG2
  
  WB Suggested Anti-CSTF2T Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:62500
  Positive Control: HepG2 cell lysate