| Product Number |
ARP40768_T100 |
| Product Page |
www.avivasysbio.com/csdc2-antibody-n-terminal-region-arp40768-t100.html |
| Name |
CSDC2 Antibody - N-terminal region (ARP40768_T100) |
| Protein Size (# AA) |
153 amino acids |
| Molecular Weight |
17kDa |
| NCBI Gene Id |
27254 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Cold shock domain containing C2, RNA binding |
| Alias Symbols |
PIPPIN, dJ347H13.2 |
| Peptide Sequence |
Synthetic peptide located within the following region: MTSESTSPPVVPPLHSPKSPVWPTFPFHREGSRVWERGGVPPRDLPSPLP |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Collins,J.E., Genome Biol. 5 (10), R84 (2004) |
| Description of Target |
CSDC2 is an RNA-binding factor which binds specifically to the very 3'UTR ends of both histone H1 and H3.3 mRNAs, encompassing the polyadenylation signal. It might play a central role in the negative regulation of histone variant synthesis in the developing brain. |
| Protein Interactions |
PPP2R1A; MEOX2; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-CSDC2 (ARP40768_T100) antibody |
| Blocking Peptide |
For anti-CSDC2 (ARP40768_T100) antibody is Catalog # AAP40768 (Previous Catalog # AAPY01020) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human CSDC2 |
| Uniprot ID |
Q9Y534 |
| Protein Name |
Cold shock domain-containing protein C2 |
| Protein Accession # |
NP_055275 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_014460 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
CSDC2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 79%; Dog: 86%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 100% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-CSDC2 Antibody Titration: 0.625ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate |
| | Image 2 | Human Lung
 | Rabbit Anti-CSDC2 Antibody
Catalog Number: ARP40768
Paraffin Embedded Tissue: Human Lung
Cellular Data: Alveolar cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X |
|
|
