PPP1R8 Antibody - N-terminal region (ARP40753_T100)

Data Sheet
 
Product Number ARP40753_T100
Product Page www.avivasysbio.com/ppp1r8-antibody-n-terminal-region-arp40753-t100.html
Name PPP1R8 Antibody - N-terminal region (ARP40753_T100)
Protein Size (# AA) 351 amino acids
Molecular Weight 39kDa
NCBI Gene Id 5511
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Protein phosphatase 1, regulatory subunit 8
Alias Symbols ARD1, ARD-1, NIPP1, NIPP-1, PRO2047
Peptide Sequence Synthetic peptide located within the following region: THGTFLGHIRLEPHKPQQIPIDSTVSFGASTRAYTLREKPQTLPSAVKGD
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Lesage,B., (2004) J. Biol. Chem. 279 (53), 55978-55984
Description of Target This gene, through alternative splicing, encodes three different isoforms. Two of the protein isoforms encoded by this gene are specific inhibitors of type 1 serine/threonine protein phosphatases and can bind but not cleave RNA. The third protein isoform lacks the phosphatase inhibitory function but is a single-strand endoribonuclease comparable to RNase E of E. coli. This isoform requires magnesium for its function and cleaves specific sites in A+U-rich regions of RNA.
Protein Interactions APPBP2; UBC; FBXO25; HMGA1; WDR77; CTNNBL1; PPIL1; PPP1CC; PPP1CA; NF2; APP; SF3A2; Cep72; PPP1CB; SUZ12; RBBP4; EZH2; EED; RBM48; SF3B1; SETDB1; MELK; HDAC2; C14orf1; STC2; CDC5L; CRMP1; PRKACA; GBP2; LYN; CSNK2A2; CSNK2A1; NME2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-PPP1R8 (ARP40753_T100) antibody
Blocking Peptide For anti-PPP1R8 (ARP40753_T100) antibody is Catalog # AAP40753 (Previous Catalog # AAPY01005)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human PPP1R8
Uniprot ID Q12972
Protein Name Nuclear inhibitor of protein phosphatase 1
Sample Type Confirmation

PPP1R8 is supported by BioGPS gene expression data to be expressed in HepG2

Protein Accession # NP_054829
Purification Protein A purified
Nucleotide Accession # NM_014110
Tested Species Reactivity Human
Gene Symbol PPP1R8
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Image 1
Human HepG2
WB Suggested Anti-PPP1R8 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysatePPP1R8 is supported by BioGPS gene expression data to be expressed in HepG2
Image 2
Human Lung
Rabbit Anti-PPP1R8 antibody
Catalog Number: ARP40753
Paraffin Embedded Tissue: Human Lung cell Cellular Data: alveolar cell of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com