IRAK3 Antibody - C-terminal region (ARP40709_P050)

Data Sheet
 
Product Number ARP40709_P050
Product Page www.avivasysbio.com/irak3-antibody-c-terminal-region-arp40709-p050.html
Name IRAK3 Antibody - C-terminal region (ARP40709_P050)
Protein Size (# AA) 596 amino acids
Molecular Weight 66kDa
NCBI Gene Id 11213
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Interleukin-1 receptor-associated kinase 3
Alias Symbols ASRT5, IRAKM
Peptide Sequence Synthetic peptide located within the following region: NTLESTQASLYFAEDPPTSLKSFRCPSPLFLENVPSIPVEDDESQNNNLL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference del (2005) J. Immunol. 174 (5), 3032-3040
Description of Target IRAK3 contains 1 protein kinase domain and 1 death domain and belongs to the Ser/Thr protein kinase family, Pelle subfamily. It inhibits dissociation of IRAK1 and IRAK4 from the Toll-like receptor signaling complex by either inhibiting the phosphorylation of IRAK1 and IRAK4 or stabilizing the receptor complex.
Protein Interactions CDCA5; NSA2; LDB1; NTRK3; NONO; HSP90AA1; HOXB7; FOLR1; ECM1; COPB1; CD14; ATP6V0B; ADH1B; IRAK1; UBC; IRAK4; IRAK2; TICAM2; IRAK3; TRAF6; MYD88;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-IRAK3 (ARP40709_P050) antibody
Blocking Peptide For anti-IRAK3 (ARP40709_P050) antibody is Catalog # AAP40709 (Previous Catalog # AAPY00961)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human IRAK3
Uniprot ID Q9Y616
Protein Name Interleukin-1 receptor-associated kinase 3
Protein Accession # NP_009130
Purification Affinity Purified
Nucleotide Accession # NM_007199
Tested Species Reactivity Human
Gene Symbol IRAK3
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 93%; Guinea Pig: 86%; Horse: 79%; Human: 100%; Mouse: 86%; Rabbit: 79%; Rat: 86%
Image 1
Human HepG2
WB Suggested Anti-IRAK3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com