CPSF6 Antibody - middle region (ARP40697_T100)

• Product Number: ARP40697_T100
• Name: CPSF6 Antibody - middle region (ARP40697_T100)
• Protein Size (# AA): 551 amino acids
• Molecular Weight: 61kDa
• NCBI Gene Id: 11052
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Cleavage and polyadenylation specific factor 6, 68kDa
• Alias Symbols: CFIM, CFIM68, CFIM72, HPBRII-4, HPBRII-7
• Peptide Sequence: Synthetic peptide located within the following region: PPLAGPPNRGDRPPPPVLFPGQPFGQPPLGPLPPGPPPPVPGYGPPPGPP
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Rual,J.F., (2005) Nature 437 (7062), 1173-1178
• Description of Target: CPSF6 is one subunit of a cleavage factor required for 3' RNA cleavage and polyadenylation processing. The interaction of the protein with the RNA is one of the earliest steps in the assembly of the 3' end processing complex and facilitates the recruitement of other processing factors. The cleavage factor complex is composed of four polypeptides.The protein encoded by this gene is one subunit of a cleavage factor required for 3' RNA cleavage and polyadenylation processing. The interaction of the protein with the RNA is one of the earliest steps in the assembly of the 3' end processing complex and facilitates the recruitement of other processing factors. The cleavage factor complex is composed of four polypeptides. This gene encodes the 68kD subunit. It has a domain organization reminiscent of spliceosomal proteins.
• Protein Interactions: ARMC7; OTUB2; TOLLIP; PPIL1; FUS; FXR2; WWOX; EZH2; SUZ12; EED; rev; ITCH; PRPF40A; WBP4; TCERG1; NEDD4; APBB1; SRPK2; WWP1; NUDT21; LMNA; CD81; TP63; UBC; NPM1; FN1; DAB2; CSNK2A1; SMURF1; BARD1; MDC1; ZBTB8B; CPSF7; NUP107; TBC1D2; WBP11; PUF60; U2AF2;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-CPSF6 (ARP40697_T100) antibody is Catalog # AAP40697 (Previous Catalog # AAPY00949)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CPSF6
• Uniprot ID: Q16630
• Protein Name: Cleavage and polyadenylation specificity factor subunit 6
• Sample Type Confirmation:

  CPSF6 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

• Protein Accession #: NP_008938
• Purification: Protein A purified
• Nucleotide Accession #: NM_007007
• Tested Species Reactivity: Human
• Gene Symbol: CPSF6
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: IF, IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
• Image 1: Human Muscle
  
  Rabbit Anti-CPSF6 Antibody
  Catalog Number: ARP40697
  Paraffin Embedded Tissue: Human Muscle
  Cellular Data: Skeletal muscle cells
  Antibody Concentration: 16.0 ug/ml
  Magnification: 400X
• Image 2: Human Jurkat
  
  WB Suggested Anti-CPSF6 Antibody Titration: 0.3125ug/ml
  ELISA Titer: 1:1562500
  Positive Control: Jurkat cell lysateCPSF6 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells
• Image 3: SKOV3
  
  Sample Type:
  SKOV3
  Primary Antibody Dilution:
  4 ug/ml
  Secondary Antibody:
  Anti-rabbit Alexa 546
  Secondary Antibody Dilution:
  2 ug/ml
  Gene Name:
  CPSF6