Product Number |
ARP40681_T100 |
Product Page |
www.avivasysbio.com/surf6-antibody-middle-region-arp40681-t100.html |
Name |
SURF6 Antibody - middle region (ARP40681_T100) |
Protein Size (# AA) |
361 amino acids |
Molecular Weight |
40kDa |
NCBI Gene Id |
6838 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Surfeit 6 |
Alias Symbols |
RRP14 |
Peptide Sequence |
Synthetic peptide located within the following region: EPREPPGLIFNKVEVSEDEPASKAQRRKEKRQRVKGNLTPLTGRNYRQLL |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Magoulas,C. Gene 243 (1-2), 115-123 (2000) |
Description of Target |
This gene is located in the surfeit gene cluster, a group of very tightly linked genes that do not share sequence similarity. The gene demonstrates features of a housekeeping gene, being ubiquitously expressed, and the encoded protein has been localized to the nucleolus. The protein includes motifs found in both the mouse and fish orthologs, which suggests a putative function as a nucleolar-matrix protein with nucleic acid-binding properties, based on characteristics determined in mouse.This gene is located in the surfeit gene cluster, a group of very tightly linked genes that do not share sequence similarity. The gene demonstrates features of a housekeeping gene, being ubiquitously expressed, and the encoded protein has been localized to the nucleolus. The protein includes motifs found in both the mouse and fish orthologs, which suggests a putative function as a nucleolar-matrix protein with nucleic acid-binding properties, based on characteristics determined in mouse. |
Protein Interactions |
UBC; LIN28A; CSNK2A1; SIRT7; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-SURF6 (ARP40681_T100) antibody |
Blocking Peptide |
For anti-SURF6 (ARP40681_T100) antibody is Catalog # AAP40681 (Previous Catalog # AAPY00933) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human SURF6 |
Uniprot ID |
O75683 |
Protein Name |
Surfeit locus protein 6 |
Protein Accession # |
NP_006744 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_006753 |
Tested Species Reactivity |
Human |
Gene Symbol |
SURF6 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Guinea Pig, Horse |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 86%; Rat: 93% |
Image 1 | Human Jurkat
| WB Suggested Anti-SURF6 Antibody Titration: 2.5ug/ml ELISA Titer: 1:312500 Positive Control: Jurkat cell lysate |
|
Image 2 | Human Kidney
| Rabbit Anti-SURF6 Antibody Catalog Number: ARP40681 Paraffin Embedded Tissue: Human Kidney Cellular Data: Epithelial cells of renal tubule Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X |
|
Image 3 | Human Heart
| Rabbit Anti-SURF6 Antibody Catalog Number: ARP40681 Paraffin Embedded Tissue: Human Heart Cellular Data: Myocardial cells Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X |
|