SURF6 Antibody - middle region (ARP40681_T100)

Data Sheet
 
Product Number ARP40681_T100
Product Page www.avivasysbio.com/surf6-antibody-middle-region-arp40681-t100.html
Name SURF6 Antibody - middle region (ARP40681_T100)
Protein Size (# AA) 361 amino acids
Molecular Weight 40kDa
NCBI Gene Id 6838
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Surfeit 6
Alias Symbols RRP14
Peptide Sequence Synthetic peptide located within the following region: EPREPPGLIFNKVEVSEDEPASKAQRRKEKRQRVKGNLTPLTGRNYRQLL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Magoulas,C. Gene 243 (1-2), 115-123 (2000)
Description of Target This gene is located in the surfeit gene cluster, a group of very tightly linked genes that do not share sequence similarity. The gene demonstrates features of a housekeeping gene, being ubiquitously expressed, and the encoded protein has been localized to the nucleolus. The protein includes motifs found in both the mouse and fish orthologs, which suggests a putative function as a nucleolar-matrix protein with nucleic acid-binding properties, based on characteristics determined in mouse.This gene is located in the surfeit gene cluster, a group of very tightly linked genes that do not share sequence similarity. The gene demonstrates features of a housekeeping gene, being ubiquitously expressed, and the encoded protein has been localized to the nucleolus. The protein includes motifs found in both the mouse and fish orthologs, which suggests a putative function as a nucleolar-matrix protein with nucleic acid-binding properties, based on characteristics determined in mouse.
Protein Interactions UBC; LIN28A; CSNK2A1; SIRT7;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-SURF6 (ARP40681_T100) antibody
Blocking Peptide For anti-SURF6 (ARP40681_T100) antibody is Catalog # AAP40681 (Previous Catalog # AAPY00933)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human SURF6
Uniprot ID O75683
Protein Name Surfeit locus protein 6
Protein Accession # NP_006744
Purification Protein A purified
Nucleotide Accession # NM_006753
Tested Species Reactivity Human
Gene Symbol SURF6
Predicted Species Reactivity Human, Mouse, Rat, Cow, Guinea Pig, Horse
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 86%; Rat: 93%
Image 1
Human Jurkat
WB Suggested Anti-SURF6 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate
Image 2
Human Kidney
Rabbit Anti-SURF6 Antibody
Catalog Number: ARP40681
Paraffin Embedded Tissue: Human Kidney
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
Image 3
Human Heart
Rabbit Anti-SURF6 Antibody
Catalog Number: ARP40681
Paraffin Embedded Tissue: Human Heart
Cellular Data: Myocardial cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com