CPSF4 Antibody - C-terminal region (ARP40675_P050)

• Product Number: ARP40675_P050
• Name: CPSF4 Antibody - C-terminal region (ARP40675_P050)
• Protein Size (# AA): 216 amino acids
• Molecular Weight: 24kDa
• Subunit: 4
• NCBI Gene Id: 10898
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Cleavage and polyadenylation specific factor 4, 30kDa
• Alias Symbols: NAR, NEB1, NEB-1, CPSF30
• Peptide Sequence: Synthetic peptide located within the following region: SLIQLTSQNSSPNQQRTPQVIGVMQSQNSSAGNRGPRPLEQVTCYKCGEK
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: Inhibition of the nuclear export of poly(A)-containing mRNAs caused by the influenza A virus NS1 protein requires its effector domain. The NS1 effector domain functionally interacts with the cellular 30 kDa subunit of cleavage and polyadenylation specific factor 4, an essential component of the 3' end processing machinery of cellular pre-mRNAs. In influenza virus-infected cells, the NS1 protein is physically associated with cleavage and polyadenylation specific factor 4, 30kD subunit. Binding of the NS1 protein to the 30 kDa protein in vitro prevents CPSF binding to the RNA substrate and inhibits 3' end cleavage and polyadenylation of host pre-mRNAs. Thus the NS1 protein selectively inhibits the nuclear export of cellular, and not viral, mRNAs.
• Protein Interactions: FIP1L1; RBBP6; MEOX2; CLK2; NPM1; MDC1; ECT2; UBC; CSTF2T; RRAGA; CDC73; SLC12A9; MARK3;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-CPSF4 (ARP40675_P050) antibody is Catalog # AAP40675 (Previous Catalog # AAPY00927)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CPSF4
• Uniprot ID: O95639
• Protein Name: Cleavage and polyadenylation specificity factor subunit 4
• Sample Type Confirmation:

  CPSF4 is supported by BioGPS gene expression data to be expressed in Jurkat

• Protein Accession #: EAW76662
• Purification: Affinity Purified
• Nucleotide Accession #: NM_001081559
• Tested Species Reactivity: Human
• Gene Symbol: CPSF4
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
• Image 1: Human Jurkat
  
  WB Suggested Anti-CPSF4 Antibody Titration: 0.2-1 ug/ml
  Positive Control: Jurkat cell lysateCPSF4 is supported by BioGPS gene expression data to be expressed in Jurkat