SARS Antibody - C-terminal region (ARP40654_T100)

Data Sheet
 
Product Number ARP40654_T100
Product Page www.avivasysbio.com/sars-antibody-c-terminal-region-arp40654-t100.html
Name SARS Antibody - C-terminal region (ARP40654_T100)
Protein Size (# AA) 514 amino acids
Molecular Weight 57kDa
NCBI Gene Id 6301
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Seryl-tRNA synthetase
Alias Symbols SARS, SERS, SERRS, NEDMAS
Peptide Sequence Synthetic peptide located within the following region: PEKLKEFMPPGLQELIPFVKPAPIEQEPSKKQKKQHEGSKKKAAARDVTL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Shimada,N., (2001) J. Biol. Chem. 276 (50), 46770-46778
Description of Target SARS belongs to the class II amino-acyl tRNA family. The enzyme catalyzes the transfer of L-serine to tRNA (Ser) and is related to bacterial and yeast counterparts.This gene belongs to the class II amino-acyl tRNA family. The encoded enzyme catalyzes the transfer of L-serine to tRNA (Ser) and is related to bacterial and yeast counterparts.
Protein Interactions UBC; TBCD; STAT1; GTF2E1; GTF2A1; CTTN; ATP6V1C1; ANP32E; ACBD3; ELAC2; XPO5; DUS3L; SNX5; ASF1A; ATG7; EFTUD2; TTC1; gag-pol; GATC; PALLD; TARS; CDK2; TINF2; POT1; TERF1; MYC; UBA5; TRS-AGA2-4; JUN; SIRT2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-SARS (ARP40654_T100) antibody
Blocking Peptide For anti-SARS (ARP40654_T100) antibody is Catalog # AAP40654 (Previous Catalog # AAPP10402)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human SARS
Uniprot ID Q5T5C8
Protein Name Serine--tRNA ligase, cytoplasmic
Protein Accession # NP_006504
Purification Protein A purified
Nucleotide Accession # NM_006513
Tested Species Reactivity Human
Gene Symbol SARS
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%
Image 1
Human Jurkat
WB Suggested Anti-SARS Antibody Titration: 1.25ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com