| Product Number |
ARP40653_P050 |
| Product Page |
www.avivasysbio.com/rad51ap1-antibody-middle-region-arp40653-p050.html |
| Name |
RAD51AP1 Antibody - middle region (ARP40653_P050) |
| Protein Size (# AA) |
335 amino acids |
| Molecular Weight |
37kDa |
| NCBI Gene Id |
10635 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
RAD51 associated protein 1 |
| Alias Symbols |
PIR51 |
| Peptide Sequence |
Synthetic peptide located within the following region: EDDVGGVQGKRKAASKAAAQQRKILLEGSDGDSANDTEPDFAPGEDSEDD |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
RAD51AP1 may participate in a common DNA damage response pathway associated with the activation of homologous recombination and double-strand break repair. RAD51AP1 binds to single and double stranded DNA, and is capable of aggregating DNA. RAD51AP1 also binds RNA. |
| Protein Interactions |
SIAH1; UBC; APP; NEDD4; RAD51; PALB2; USP12; USP46; WDR48; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-RAD51AP1 (ARP40653_P050) antibody |
| Blocking Peptide |
For anti-RAD51AP1 (ARP40653_P050) antibody is Catalog # AAP40653 (Previous Catalog # AAPY00905) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human RAD51AP1 |
| Uniprot ID |
A8K7D3 |
| Protein Name |
RAD51-associated protein 1 |
| Protein Accession # |
NP_006470 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_006479 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
RAD51AP1 |
| Predicted Species Reactivity |
Human, Rat, Dog, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Dog: 93%; Horse: 86%; Human: 100%; Rabbit: 79%; Rat: 92% |
| Image 1 | Human Muscle
 | WB Suggested Anti-RAD51AP1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Muscle |
|
|
