PRPF8 Antibody - N-terminal region (ARP40649_P050)

Data Sheet
 
Product Number ARP40649_P050
Product Page www.avivasysbio.com/prpf8-antibody-n-terminal-region-arp40649-p050.html
Name PRPF8 Antibody - N-terminal region (ARP40649_P050)
Protein Size (# AA) 2335 amino acids
Molecular Weight 273kDa
NCBI Gene Id 10594
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name PRP8 pre-mRNA processing factor 8 homolog (S. cerevisiae)
Alias Symbols PRP8, RP13, HPRP8, PRPC8, SNRNP220
Peptide Sequence Synthetic peptide located within the following region: SHRHSVKSQEPLPDDDEEFELPEFVEPFLKDTPLYTDNTANGIALLWAPR
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Pena,V., (2007) Mol. Cell 25 (4), 615-624
Description of Target Pre-mRNA splicing occurs in 2 sequential transesterification steps. PRPF8 is a component of both U2- and U12-dependent spliceosomes, and found to be essential for the catalytic step II in pre-mRNA splicing process. It contains several WD repeats, which function in protein-protein interactions. This protein has a sequence similarity to yeast Prp8 protein. The gene encoding PRPF8 is a candidate gene for autosomal dominant retinitis pigmentosa.Pre-mRNA splicing occurs in 2 sequential transesterification steps. The protein encoded by this gene is a component of both U2- and U12-dependent spliceosomes, and found to be essential for the catalytic step II in pre-mRNA splicing process. It contains several WD repeats, which function in protein-protein interactions. This protein has a sequence similarity to yeast Prp8 protein. This gene is a candidate gene for autosomal dominant retinitis pigmentosa. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Interactions SNRNP200; PRPF8; EFTUD2; UBC; CDKN1A; SUMO2; SUMO3; STAU1; LGR4; NEDD8; ERG; ASB15; WWOX; RPA3; RPA2; RPA1; EED; RNF2; SUZ12; rev; PIN1; NEDD4; FBXO6; PRPF4B; UBD; IGSF8; ICAM1; SND1; SF3B2; SLU7; ZNF830; WDR83; PRPF19; GPKOW; FN1; BCAS2; SF3B4; RBM5; VCA
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-PRPF8 (ARP40649_P050) antibody
Blocking Peptide For anti-PRPF8 (ARP40649_P050) antibody is Catalog # AAP40649 (Previous Catalog # AAPY00904)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human PRPF8
Uniprot ID Q6P2Q9
Protein Name Pre-mRNA-processing-splicing factor 8
Sample Type Confirmation

PRPF8 is supported by BioGPS gene expression data to be expressed in Jurkat

Protein Accession # NP_006436
Purification Affinity Purified
Nucleotide Accession # NM_006445
Tested Species Reactivity Human
Gene Symbol PRPF8
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Image 1
Human Jurkat
WB Suggested Anti-PRPF8 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysatePRPF8 is supported by BioGPS gene expression data to be expressed in Jurkat
Image 2
Human A549 Whole Cell
Host: Rabbit
Target Name: PRPF8
Sample Tissue: Human A549 Whole Cell
Antibody Dilution: 3ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com