Product Number |
ARP40646_P050 |
Product Page |
www.avivasysbio.com/rnaseh2a-antibody-c-terminal-region-arp40646-p050.html |
Name |
RNASEH2A Antibody - C-terminal region (ARP40646_P050) |
Protein Size (# AA) |
299 amino acids |
Molecular Weight |
33kDa |
Subunit |
A |
NCBI Gene Id |
10535 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Ribonuclease H2, subunit A |
Alias Symbols |
AGS4, JUNB, RNHL, RNHIA, THSD8, RNASEHI |
Peptide Sequence |
Synthetic peptide located within the following region: EKEAEDVIWEDSASENQEGLRKITSYFLNEGSQARPRSSHRYFLERGLES |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Frank,P., (1998) Proc. Natl. Acad. Sci. U.S.A. 95 (22), 12872-12877 |
Description of Target |
Of the multiple RNases H in mammals, RNase HI is the major enzyme and shows increased activity during DNA replication. It shows more homology to the RNase HII of Escherichia coli.Of the multiple RNases H in mammals, RNase HI is the major enzyme and shows increased activity during DNA replication. It shows more homology to the RNase HII of Escherichia coli.Of the multiple RNases H in mammals, RNase HI is the major enzyme and shows increased activity during DNA replication. It shows more homology to the RNase HII of Escherichia coli. |
Protein Interactions |
UBC; IPO7; UGDH; RNASEH2C; RNASEH2B; NDOR1; ITSN1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-RNASEH2A (ARP40646_P050) antibody |
Blocking Peptide |
For anti-RNASEH2A (ARP40646_P050) antibody is Catalog # AAP40646 (Previous Catalog # AAPP10623) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human RNASEH2A |
Uniprot ID |
O75792 |
Protein Name |
Ribonuclease H2 subunit A |
Sample Type Confirmation |
RNASEH2A is supported by BioGPS gene expression data to be expressed in Jurkat |
Protein Accession # |
NP_006388 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_006397 |
Tested Species Reactivity |
Human |
Gene Symbol |
RNASEH2A |
Predicted Species Reactivity |
Human |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Human: 100% |
Image 1 | Human Kidney
| Rabbit Anti-RNASEH2A Antibody Catalog Number: ARP40646 Paraffin Embedded Tissue: Human Kidney Cellular Data: Epithelial cells of renal tubule Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X |
|
Image 2 | Human Jurkat
| WB Suggested Anti-RNASEH2A Antibody Titration: 0.2-1 ug/ml Positive Control: Jurkat cell lysateRNASEH2A is supported by BioGPS gene expression data to be expressed in Jurkat |
|