RNASEH2A Antibody - C-terminal region (ARP40646_P050)

Data Sheet
 
Product Number ARP40646_P050
Product Page www.avivasysbio.com/rnaseh2a-antibody-c-terminal-region-arp40646-p050.html
Name RNASEH2A Antibody - C-terminal region (ARP40646_P050)
Protein Size (# AA) 299 amino acids
Molecular Weight 33kDa
Subunit A
NCBI Gene Id 10535
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Ribonuclease H2, subunit A
Alias Symbols AGS4, JUNB, RNHL, RNHIA, THSD8, RNASEHI
Peptide Sequence Synthetic peptide located within the following region: EKEAEDVIWEDSASENQEGLRKITSYFLNEGSQARPRSSHRYFLERGLES
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Frank,P., (1998) Proc. Natl. Acad. Sci. U.S.A. 95 (22), 12872-12877
Description of Target Of the multiple RNases H in mammals, RNase HI is the major enzyme and shows increased activity during DNA replication. It shows more homology to the RNase HII of Escherichia coli.Of the multiple RNases H in mammals, RNase HI is the major enzyme and shows increased activity during DNA replication. It shows more homology to the RNase HII of Escherichia coli.Of the multiple RNases H in mammals, RNase HI is the major enzyme and shows increased activity during DNA replication. It shows more homology to the RNase HII of Escherichia coli.
Protein Interactions UBC; IPO7; UGDH; RNASEH2C; RNASEH2B; NDOR1; ITSN1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-RNASEH2A (ARP40646_P050) antibody
Blocking Peptide For anti-RNASEH2A (ARP40646_P050) antibody is Catalog # AAP40646 (Previous Catalog # AAPP10623)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human RNASEH2A
Uniprot ID O75792
Protein Name Ribonuclease H2 subunit A
Sample Type Confirmation

RNASEH2A is supported by BioGPS gene expression data to be expressed in Jurkat

Protein Accession # NP_006388
Purification Affinity Purified
Nucleotide Accession # NM_006397
Tested Species Reactivity Human
Gene Symbol RNASEH2A
Predicted Species Reactivity Human
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Human: 100%
Image 1
Human Kidney
Rabbit Anti-RNASEH2A Antibody
Catalog Number: ARP40646
Paraffin Embedded Tissue: Human Kidney
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
Image 2
Human Jurkat
WB Suggested Anti-RNASEH2A Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysateRNASEH2A is supported by BioGPS gene expression data to be expressed in Jurkat
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com