HDLBP Antibody - N-terminal region (ARP40581_P050)

Data Sheet
 
Product Number ARP40581_P050
Product Page www.avivasysbio.com/hdlbp-antibody-n-terminal-region-arp40581-p050.html
Name HDLBP Antibody - N-terminal region (ARP40581_P050)
Protein Size (# AA) 1268 amino acids
Molecular Weight 141kDa
NCBI Gene Id 3069
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name High density lipoprotein binding protein
Alias Symbols HBP, VGL, PRO2900
Peptide Sequence Synthetic peptide located within the following region: MSSVAVLTQESFAEHRSGLVPQQIKVATLNSEEESDPPTYKDAFPPLPEK
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Beausoleil,S.A., (2004) Proc. Natl. Acad. Sci. U.S.A. 101 (33), 12130-12135
Description of Target HDLBP is high density lipoprotein-binding protein, also known as vigilin, is a 110-kD protein that specifically binds HDL molecules and may function in the removal of excess cellular cholesterol.High density lipoprotein-binding protein, also known as vigilin, is a 110-kD protein that specifically binds HDL molecules and may function in the removal of excess cellular cholesterol.High density lipoprotein-binding protein, also known as vigilin, is a 110-kD protein that specifically binds HDL molecules and may function in the removal of excess cellular cholesterol.[supplied by OMIM].
Protein Interactions UBC; MDM2; LGR4; WWOX; EIF2A; KCMF1; DYNLL1; IKBKG; FAU; SMAD4; CSNK2A1; FAM46A; WHSC1; VCP; ZNF598; VPS25; VPS35; UBA6; VPS29; VPS36; TOPBP1; S100A11; S100A10; UPF1; PSMD12; UBE4B; VPS26A; ZW10; UBE2A; TYRO3; TTK; TTC4; PLAUR; ATP6V1B2; COPS5; CDK2; SIRT
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-HDLBP (ARP40581_P050) antibody
Blocking Peptide For anti-HDLBP (ARP40581_P050) antibody is Catalog # AAP40581 (Previous Catalog # AAPP22757)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human HDLBP
Uniprot ID Q00341
Protein Name Vigilin
Protein Accession # NP_005327
Purification Affinity Purified
Nucleotide Accession # NM_005336
Tested Species Reactivity Human
Gene Symbol HDLBP
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB, IP
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%
Image 1
Human Jurkat
WB Suggested Anti-HDLBP Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate
Image 2
HEK293 Whole Cell Lysate
HDLBP was immunoprecipitated from 1 mg HEK293 Whole Cell Lysate with ARP40581_P050 with 1:200 dilution. Western blot was performed using ARP40581_P050 at 1/1000 dilution.
Lane 1: Control IP in HEK293 Whole Cell Lysate.
Lane 2: HDLBP IP with ARP40581_P050 in HEK293 Whole Cell Lysate.
Lane 3: Input of HEK293 Whole Cell Lysate.
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com