RRP9 Antibody - middle region (ARP40546_T100)

Data Sheet
 
Product Number ARP40546_T100
Product Page www.avivasysbio.com/rrp9-antibody-middle-region-arp40546-t100.html
Name RRP9 Antibody - middle region (ARP40546_T100)
Protein Size (# AA) 475 amino acids
Molecular Weight 52kDa
NCBI Gene Id 9136
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Ribosomal RNA processing 9, small subunit (SSU) processome component, homolog (yeast)
Alias Symbols U3-55K, RNU3IP2
Peptide Sequence Synthetic peptide located within the following region: IPRAKKGAEGKPPGHSSHVLCMAISSDGKYLASGDRSKLILIWEAQSCQH
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Verheggen,C., (2002) EMBO J. 21 (11), 2736-2745
Description of Target RRP9 contains 7 WD repeats and belongs to the WD repeat RRP9 family. It is a component of a nucleolar small nuclear ribonucleoprotein particle (snoRNP) thought to participate in the processing and modification of pre-ribosomal RNA.
Protein Interactions LIN28A; ZNF346; TARBP2; HECW2; UBC; CSNK2A1; WDR36; THOC6; TXNDC9; THOC1; THOC5; VIM; UTRN; PWP2; SIRT7; RAP2A; Nhp2l1; SMURF1; SNORD3A;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-RRP9 (ARP40546_T100) antibody
Blocking Peptide For anti-RRP9 (ARP40546_T100) antibody is Catalog # AAP40546 (Previous Catalog # AAPP22724)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human RRP9
Uniprot ID O43818
Protein Name U3 small nucleolar RNA-interacting protein 2
Sample Type Confirmation

RRP9 is supported by BioGPS gene expression data to be expressed in Jurkat

Protein Accession # NP_004695
Purification Protein A purified
Nucleotide Accession # NM_004704
Tested Species Reactivity Human
Gene Symbol RRP9
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 79%; Dog: 79%; Guinea Pig: 79%; Horse: 93%; Human: 100%; Mouse: 79%; Pig: 93%; Rabbit: 93%; Rat: 86%
Image 1
Human Jurkat
WB Suggested Anti-RRP9 Antibody Titration: 5.0ug/ml
Positive Control: Jurkat cell lysateRRP9 is supported by BioGPS gene expression data to be expressed in Jurkat
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com