Product Number |
ARP40504_T100 |
Product Page |
www.avivasysbio.com/cpne1-antibody-n-terminal-region-arp40504-t100.html |
Name |
CPNE1 Antibody - N-terminal region (ARP40504_T100) |
Protein Size (# AA) |
537 amino acids |
Molecular Weight |
59kDa |
NCBI Gene Id |
8904 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Copine I |
Alias Symbols |
CPN1, COPN1 |
Peptide Sequence |
Synthetic peptide located within the following region: TVQKLRFGIYDIDNKTPELRDDDFLGGAECSLGQIVSSQVLTLPLMLKPG |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Tomsig,J.L., Biochem. J. 378 (PT 3), 1089-1094 (2004) |
Description of Target |
Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm. CPNE1 is a calcium-dependent protein that also contains two N-terminal type II C2 domains and an integrin A domain-like sequence in the C-terminus. However, the protein does not contain a predicted signal sequence or transmembrane domains. This protein has a broad tissue distribution and it may function in membrane trafficking.Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm. This gene encodes a calcium-dependent protein that also contains two N-terminal type II C2 domains and an integrin A domain-like sequence in the C-terminus. However, the encoded protein does not contain a predicted signal sequence or transmembrane domains. This protein has a broad tissue distribution and it may function in membrane trafficking. This gene and the gene for RNA binding motif protein 12 overlap at map location 20q11.21. Sequence analysis identified multiple alternatively spliced variants in the 5' UTR. All variants encode the same protein. |
Protein Interactions |
UBC; BAG3; BUB3; STK3; FN1; LIG4; TIMM13; TTLL12; ST13; PYGB; ARRB2; SUMO2; UIMC1; HNRNPH1; UBE2O; WTAP; MYCBP; PITPNM2; CCDC22; BCOR; CPNE4; CPNE1; UBE2M; PDCD6; PPP5C; SPTBN1; RDX; MAP2K1; SKIL; ACTB; Cdc42bpb; Etl4; Cenpf; Mycbp2; Alg2; Nono; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-CPNE1 (ARP40504_T100) antibody |
Blocking Peptide |
For anti-CPNE1 (ARP40504_T100) antibody is Catalog # AAP40504 (Previous Catalog # AAPP22709) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human CPNE1 |
Uniprot ID |
Q99829 |
Protein Name |
Copine-1 |
Sample Type Confirmation |
CPNE1 is supported by BioGPS gene expression data to be expressed in HepG2 |
Protein Accession # |
NP_003906 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_003915 |
Tested Species Reactivity |
Human |
Gene Symbol |
CPNE1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Sheep: 93%; Zebrafish: 79% |
Image 1 | Human Intestine
| Rabbit Anti-CPNE1 Antibody Catalog Number: ARP40504 Paraffin Embedded Tissue: Human Intestine Cellular Data: Epithelial cells of intestinal villas Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X |
|
Image 2 | Human HepG2
| WB Suggested Anti-CPNE1 Antibody Titration: 5.0ug/ml Positive Control: HepG2 cell lysateCPNE1 is supported by BioGPS gene expression data to be expressed in HepG2 |
|