CPNE1 Antibody - N-terminal region (ARP40504_T100)

Data Sheet
 
Product Number ARP40504_T100
Product Page www.avivasysbio.com/cpne1-antibody-n-terminal-region-arp40504-t100.html
Name CPNE1 Antibody - N-terminal region (ARP40504_T100)
Protein Size (# AA) 537 amino acids
Molecular Weight 59kDa
NCBI Gene Id 8904
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Copine I
Alias Symbols CPN1, COPN1
Peptide Sequence Synthetic peptide located within the following region: TVQKLRFGIYDIDNKTPELRDDDFLGGAECSLGQIVSSQVLTLPLMLKPG
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Tomsig,J.L., Biochem. J. 378 (PT 3), 1089-1094 (2004)
Description of Target Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm. CPNE1 is a calcium-dependent protein that also contains two N-terminal type II C2 domains and an integrin A domain-like sequence in the C-terminus. However, the protein does not contain a predicted signal sequence or transmembrane domains. This protein has a broad tissue distribution and it may function in membrane trafficking.Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm. This gene encodes a calcium-dependent protein that also contains two N-terminal type II C2 domains and an integrin A domain-like sequence in the C-terminus. However, the encoded protein does not contain a predicted signal sequence or transmembrane domains. This protein has a broad tissue distribution and it may function in membrane trafficking. This gene and the gene for RNA binding motif protein 12 overlap at map location 20q11.21. Sequence analysis identified multiple alternatively spliced variants in the 5' UTR. All variants encode the same protein.
Protein Interactions UBC; BAG3; BUB3; STK3; FN1; LIG4; TIMM13; TTLL12; ST13; PYGB; ARRB2; SUMO2; UIMC1; HNRNPH1; UBE2O; WTAP; MYCBP; PITPNM2; CCDC22; BCOR; CPNE4; CPNE1; UBE2M; PDCD6; PPP5C; SPTBN1; RDX; MAP2K1; SKIL; ACTB; Cdc42bpb; Etl4; Cenpf; Mycbp2; Alg2; Nono;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CPNE1 (ARP40504_T100) antibody
Blocking Peptide For anti-CPNE1 (ARP40504_T100) antibody is Catalog # AAP40504 (Previous Catalog # AAPP22709)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human CPNE1
Uniprot ID Q99829
Protein Name Copine-1
Sample Type Confirmation

CPNE1 is supported by BioGPS gene expression data to be expressed in HepG2

Protein Accession # NP_003906
Purification Protein A purified
Nucleotide Accession # NM_003915
Tested Species Reactivity Human
Gene Symbol CPNE1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Sheep: 93%; Zebrafish: 79%
Image 1
Human Intestine
Rabbit Anti-CPNE1 Antibody
Catalog Number: ARP40504
Paraffin Embedded Tissue: Human Intestine
Cellular Data: Epithelial cells of intestinal villas
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
Image 2
Human HepG2
WB Suggested Anti-CPNE1 Antibody Titration: 5.0ug/ml
Positive Control: HepG2 cell lysateCPNE1 is supported by BioGPS gene expression data to be expressed in HepG2
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com