EIF3S4 Antibody - N-terminal region (ARP40486_T100)

Data Sheet
 
Product Number ARP40486_T100
Product Page www.avivasysbio.com/eif3s4-antibody-n-terminal-region-arp40486-t100.html
Name EIF3S4 Antibody - N-terminal region (ARP40486_T100)
Protein Size (# AA) 320 amino acids
Molecular Weight 35kDa
Subunit G
NCBI Gene Id 8666
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Eukaryotic translation initiation factor 3, subunit G
Alias Symbols EIF3S4, EIF3-P42, eIF3-p44, eIF3-delta
Peptide Sequence Synthetic peptide located within the following region: SPEPELLPGAPLPPPKEVINGNIKTVTEYKIDEDGKKFKIVRTFRIETRK
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Ogawa,F., (2005) Biochem. Biophys. Res. Commun. 338 (2), 771-776
Description of Target EIF3S4 contains 1 RRM (RNA recognition motif) domain. It binds to the 40S ribosome and promotes the binding of methionyl-tRNAi and mRNA. This subunit binds to the 18S rRNA.
Protein Interactions FAM9B; GOLGA2; SUMO2; EIF3I; NCL; DYNC1I2; EIF3B; EIF3C; NPM1; ICAM1; CD81; IGSF8; PAN2; EIF3D; DDX3X; gag-pol; EIF3L; EIF3K; EIF3M; EIF3H; EIF3F; EIF3A; EIF3E; APP; CUL3; ACD; POT1; YWHAZ; UBC; GADD45G; TK1; SNCA; SMN1; PKN2; PIN1; Itsn2; USP3; MPHOSPH6;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-EIF3G (ARP40486_T100) antibody
Blocking Peptide For anti-EIF3G (ARP40486_T100) antibody is Catalog # AAP40486 (Previous Catalog # AAPP22254)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human EIF3S4
Uniprot ID O75821
Protein Name Eukaryotic translation initiation factor 3 subunit G
Protein Accession # NP_003746
Purification Protein A purified
Nucleotide Accession # NM_003755
Tested Species Reactivity Human
Gene Symbol EIF3G
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Pig, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Zebrafish: 79%
Image 1
Human HepG2
WB Suggested Anti-EIF3S4 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate
Image 2
Human Kidney
Rabbit Anti-EIF3S4 Antibody
Catalog Number: ARP40486
Paraffin Embedded Tissue: Human Kidney
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com