| Product Number |
ARP40479_P050 |
| Product Page |
www.avivasysbio.com/oasl1-antibody-c-terminal-region-arp40479-p050.html |
| Name |
Oasl1 Antibody - C-terminal region (ARP40479_P050) |
| Protein Size (# AA) |
511 amino acids |
| Molecular Weight |
59 kDa |
| NCBI Gene Id |
231655 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
2'-5' oligoadenylate synthetase-like 1 |
| Alias Symbols |
oasl9, 7530414C13Rik |
| Peptide Sequence |
Synthetic peptide located within the following region: ICLLDTISPEIQVFVKNPDGRSHAYAIHPLDYVLNLKQQIEDRQGLRCQE |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function of this protein remains unknown. |
| Protein Interactions |
DSK2; VPS9; NUB1; UBQLN1; SQSTM1; RAD23B; PSMD4; NBR1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Enhanced Validation |
|
| Datasheets/Manuals |
Printable datasheet for anti-Oasl1 (ARP40479_P050) antibody |
| Blocking Peptide |
For anti-Oasl1 (ARP40479_P050) antibody is Catalog # AAP40479 (Previous Catalog # AAPY01950) |
| Uniprot ID |
Q8VI94 |
| Protein Name |
2'-5'-oligoadenylate synthase-like protein 1 |
| Protein Accession # |
NP_660210 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_145209 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Oasl1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Dog: 100%; Guinea Pig: 100%; Horse: 92%; Human: 100%; Mouse: 100%; Rabbit: 85%; Rat: 100% |
| Image 1 | Mouse Brain
 | WB Suggested Anti-Oasl1 Antibody
Titration: 1.0 ug/ml
Positive Control: Mouse Brain |
| | Image 2 | Mouse Kidney
 | Host: Rabbit
Target Name: OASL
Sample Tissue: Mouse Kidney
Antibody Dilution: 1ug/ml |
|
|
