YARS Antibody - C-terminal region (ARP40471_T100)

• Product Number: ARP40471_T100
• Name: YARS Antibody - C-terminal region (ARP40471_T100)
• Protein Size (# AA): 528 amino acids
• Molecular Weight: 58kDa
• NCBI Gene Id: 8565
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Tyrosyl-tRNA synthetase
• Alias Symbols: YRS, YTS, YARS, TYRRS, CMTDIC
• Peptide Sequence: Synthetic peptide located within the following region: QVEPLDPPAGSAPGEHVFVKGYEKGQPDEELKPKKKVFEKLQADFKISEE
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Jordanova,A., (2006) Nat. Genet. 38 (2), 197-202
• Description of Target: Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Tyrosyl-tRNA synthetase belongs to the class I tRNA synthetase family. Cytokine activities have also been observed for the human tyrosyl-tRNA synthetase, after it is split into two parts, an N-terminal fragment that harbors the catalytic site and a C-terminal fragment found only in the mammalian enzyme. The N-terminal fragment is an interleukin-8-like cytokine, whereas the released C-terminal fragment is an EMAP II-like cytokine.Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Tyrosyl-tRNA synthetase belongs to the class I tRNA synthetase family. Cytokine activities have also been observed for the human tyrosyl-tRNA synthetase, after it is split into two parts, an N-terminal fragment that harbors the catalytic site and a C-terminal fragment found only in the mammalian enzyme. The N-terminal fragment is an interleukin-8-like cytokine, whereas the released C-terminal fragment is an EMAP II-like cytokine.
• Protein Interactions: UBC; SARNP; NRD1; HSPA8; VCAM1; ITGA4; FN1; METTL16; XRCC5; DYNC1H1; CDK2; ELANE; EIF1B; SAP18; EIF6; ARF6;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-YARS (ARP40471_T100) antibody is Catalog # AAP40471 (Previous Catalog # AAPP22239)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human YARS
• Uniprot ID: P54577
• Protein Name: Tyrosine--tRNA ligase, cytoplasmic
• Sample Type Confirmation:

  YARS is supported by BioGPS gene expression data to be expressed in Jurkat

• Protein Accession #: NP_003671
• Purification: Protein A purified
• Nucleotide Accession #: NM_003680
• Tested Species Reactivity: Human
• Gene Symbol: YARS
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Goat: 91%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
• Image 1: Human Jurkat
  
  WB Suggested Anti-YARS Antibody Titration: 2.5ug/ml
  Positive Control: Jurkat cell lysateYARS is supported by BioGPS gene expression data to be expressed in Jurkat