SRP19 Antibody - middle region (ARP40456_T100)

Data Sheet
 
Product Number ARP40456_T100
Product Page www.avivasysbio.com/srp19-antibody-middle-region-arp40456-t100.html
Name SRP19 Antibody - middle region (ARP40456_T100)
Protein Size (# AA) 144 amino acids
Molecular Weight 16kDa
NCBI Gene Id 6728
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Signal recognition particle 19kDa
Peptide Sequence Synthetic peptide located within the following region: LCLVQFPSRKSVMLYAAEMIPKLKTRTQKTGGADQSLQQGEGSKKGKGKK
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Kuglstatter,A., (2002) Nat. Struct. Biol. 9 (10), 740-744
Description of Target SRP19 belongs to the SRP19 family. It is signal-recognition-particle assembly and binds directly to 7S RNA and mediates binding of the 54 kDa subunit of the SRP.
Protein Interactions STAM2; ACTN1; BAG3; SMN1; MDN1; ZC3H11A; EIF4A3; ZFAND5; UBC; IPO8; IPO7; SRP54; TNPO1; KPNA1; IPO5;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-SRP19 (ARP40456_T100) antibody
Blocking Peptide For anti-SRP19 (ARP40456_T100) antibody is Catalog # AAP40456 (Previous Catalog # AAPP22224)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human SRP19
Uniprot ID P09132
Protein Name Signal recognition particle 19 kDa protein
Publications

Arana-Argáez, V. E. et al. Inhibitors of MAPK pathway ERK1/2 or p38 prevent the IL-1{beta}-induced up-regulation of SRP72 autoantigen in Jurkat cells. J. Biol. Chem. 285, 32824-33 (2010). 20729213

Sample Type Confirmation

SRP19 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

Protein Accession # NP_003126
Purification Protein A purified
Nucleotide Accession # NM_003135
Tested Species Reactivity Human
Gene Symbol SRP19
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Horse: 93%; Human: 100%; Mouse: 92%; Pig: 93%; Rabbit: 85%; Rat: 92%; Zebrafish: 77%
Image 1
Human Jurkat
WB Suggested Anti-SRP19 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysateSRP19 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells
Image 2
Human Skin
Rabbit Anti-SRP19 Antibody
Catalog Number: ARP40456
Paraffin Embedded Tissue: Human Skin
Cellular Data: Squamous epithelial cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com