| Product Number |
ARP40441_T100 |
| Product Page |
www.avivasysbio.com/snrpa1-antibody-c-terminal-region-arp40441-t100.html |
| Name |
SNRPA1 Antibody - C-terminal region (ARP40441_T100) |
| Protein Size (# AA) |
160 amino acids |
| Molecular Weight |
18kDa |
| NCBI Gene Id |
652595 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Similar to U2 small nuclear ribonucleoprotein A (U2 snRNP-A) |
| Peptide Sequence |
Synthetic peptide located within the following region: RRSKTFNPGAGLPTDKKKGGPSPGDVEAIKNAIANASTLAEVERLKGLLQ |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Fan Y,.Genome Res. 2002 Nov;12(11):1663-72. |
| Description of Target |
SNRPA1 contains 3 LRR (leucine-rich) repeats and belongs to the U2 small nuclear ribonucleoprotein A family. It is associated with sn-RNP U2 and helps the A' protein to bind stem loop IV of U2 snRNA. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-LOC652595 (ARP40441_T100) antibody |
| Blocking Peptide |
For anti-LOC652595 (ARP40441_T100) antibody is Catalog # AAP40441 (Previous Catalog # AAPP22182) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human SNRPA1 |
| Protein Accession # |
XP_947210 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
XM_942117 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
LOC652595 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Sheep: 100% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-SNRPA1 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysate |
| | Image 2 | Human Kidney
 | Rabbit Anti-SNRPA1 Antibody
Catalog Number: ARP40441
Paraffin Embedded Tissue: Human Kidney
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X |
|
|
