PPP1R8 Antibody - middle region (ARP40412_T100)

Data Sheet
 
Product Number ARP40412_T100
Product Page www.avivasysbio.com/ppp1r8-antibody-middle-region-arp40412-t100.html
Name PPP1R8 Antibody - middle region (ARP40412_T100)
Protein Size (# AA) 127 amino acids
Molecular Weight 14kDa
NCBI Gene Id 5511
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Protein phosphatase 1, regulatory subunit 8
Alias Symbols ARD1, ARD-1, NIPP1, NIPP-1, PRO2047
Peptide Sequence Synthetic peptide located within the following region: PNLAPDVDLTPVVPSAVNMNPAPNPAVYNPEAVNEPKKKKYAKEAWPGKK
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Lesage,B., (2004) J. Biol. Chem. 279 (53), 55978-55984
Description of Target This gene, through alternative splicing, encodes three different isoforms. Two of the protein isoforms encoded by this gene are specific inhibitors of type 1 serine/threonine protein phosphatases and can bind but not cleave RNA. The third protein isoform lacks the phosphatase inhibitory function but is a single-strand endoribonuclease comparable to RNase E of E. coli. This isoform requires magnesium for its function and cleaves specific sites in A+U-rich regions of RNA.
Protein Interactions APPBP2; UBC; FBXO25; HMGA1; WDR77; CTNNBL1; PPIL1; PPP1CC; PPP1CA; NF2; APP; SF3A2; Cep72; PPP1CB; SUZ12; RBBP4; EZH2; EED; RBM48; SF3B1; SETDB1; MELK; HDAC2; C14orf1; STC2; CDC5L; CRMP1; PRKACA; GBP2; LYN; CSNK2A2; CSNK2A1; NME2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-PPP1R8 (ARP40412_T100) antibody
Specificity This antibody recognizes isoform-gamma
Blocking Peptide For anti-PPP1R8 (ARP40412_T100) antibody is Catalog # AAP40412 (Previous Catalog # AAPP22153)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human PPP1R8
Uniprot ID Q12972
Protein Name Nuclear inhibitor of protein phosphatase 1
Protein Accession # NP_002704
Purification Protein A purified
Nucleotide Accession # NM_002713
Tested Species Reactivity Human
Gene Symbol PPP1R8
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 91%
Image 1
Human Thymus
WB Suggested Anti-PPP1R8 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:312500
Positive Control: Human Thymus
Image 2
Human Kidney
Rabbit Anti-PPP1R8 Antibody
Catalog Number: ARP40412
Paraffin Embedded Tissue: Human Kidney
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com