Product Number |
ARP40400_T100 |
Product Page |
www.avivasysbio.com/nova2-antibody-middle-region-arp40400-t100.html |
Name |
NOVA2 Antibody - middle region (ARP40400_T100) |
Protein Size (# AA) |
492 amino acids |
Molecular Weight |
54kDa |
NCBI Gene Id |
4858 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Neuro-oncological ventral antigen 2 |
Alias Symbols |
ANOVA, NOVA3, NEDASB, NOVA-2 |
Peptide Sequence |
Synthetic peptide located within the following region: EPEQVHKAVSAIVQKVQEDPQSSSCLNISYANVAGPVANSNPTGSPYASP |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Lewis,H.A., (2000) Cell 100 (3), 323-332 |
Description of Target |
NOVA2 may regulate RNA splicing or metabolism in a specific subset of developing neurons. It binds single strand RNA. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-NOVA2 (ARP40400_T100) antibody |
Blocking Peptide |
For anti-NOVA2 (ARP40400_T100) antibody is Catalog # AAP40400 (Previous Catalog # AAPP22830) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human NOVA2 |
Uniprot ID |
Q9UNW9 |
Protein Name |
RNA-binding protein Nova-2 |
Protein Accession # |
NP_002507 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_002516 |
Tested Species Reactivity |
Human |
Gene Symbol |
NOVA2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 82%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92% |
Image 1 | Human HepG2
| WB Suggested Anti-NOVA2 Antibody Titration: 2.5ug/ml Positive Control: HepG2 cell lysate |
|
|