| Product Number |
ARP40399_T100 |
| Product Page |
www.avivasysbio.com/nova2-antibody-n-terminal-region-arp40399-t100.html |
| Name |
NOVA2 Antibody - N-terminal region (ARP40399_T100) |
| Protein Size (# AA) |
492 amino acids |
| Molecular Weight |
54kDa |
| NCBI Gene Id |
4858 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Neuro-oncological ventral antigen 2 |
| Alias Symbols |
ANOVA, NOVA3, NEDASB, NOVA-2 |
| Peptide Sequence |
Synthetic peptide located within the following region: MEPEAPDSRKRPLETPPEVVCTKRSNTGEEGEYFLKVLIPSYAAGSIIGK |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Lewis,H.A., (2000) Cell 100 (3), 323-332 |
| Description of Target |
NOVA2 may regulate RNA splicing or metabolism in a specific subset of developing neurons. It binds single strand RNA. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-NOVA2 (ARP40399_T100) antibody |
| Blocking Peptide |
For anti-NOVA2 (ARP40399_T100) antibody is Catalog # AAP40399 (Previous Catalog # AAPS03203) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human NOVA2 |
| Uniprot ID |
Q9UNW9 |
| Protein Name |
RNA-binding protein Nova-2 |
| Protein Accession # |
NP_002507 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_002516 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
NOVA2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Pig, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 77%; Dog: 77%; Guinea Pig: 77%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 77%; Zebrafish: 100% |
| Image 1 | Human HepG2
 | WB Suggested Anti-NOVA2 Antibody Titration: 1.25ug/ml
Positive Control: HepG2 cell lysate |
|
| Image 2 | Human neural tube
 | Lanes:
1. 10 ug human neural cell lysate
2. 10 ug human non-neural cell lysate
Primary Antibody Dilution:
1:1000
Secondary Antibody:
Goat anti-rabbit IRDye 800 (1hr room temperature)
Secondary Antibody Dilution:
1:15,000
Gene Name:
NOVA2
Submitted by:
Dr. Monica Faronato, University of Liverpool
|
|
