Product Number |
ARP40397_P050 |
Product Page |
www.avivasysbio.com/nova1-antibody-c-terminal-region-arp40397-p050.html |
Name |
NOVA1 Antibody - C-terminal region (ARP40397_P050) |
Protein Size (# AA) |
507 amino acids |
Molecular Weight |
52kDa |
NCBI Gene Id |
4857 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
NOVA alternative splicing regulator 1 |
Alias Symbols |
Nova-1 |
Peptide Sequence |
Synthetic peptide located within the following region: SKKGEFVPGTRNRKVTITGTPAATQAAQYLITQRITYEQGVRAANPQKVG |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Ratti,A., (2008) J. Biol. Chem. 283 (12), 7531-7541 |
Description of Target |
NOVA1 is a neuron-specific RNA-binding protein, a member of the Nova family of paraneoplastic disease antigens, that is recognized and inhibited by paraneoplastic antibodies. These antibodies are found in the sera of patients with paraneoplastic opsoclonus-ataxia, breast cancer, and small cell lung cancer.This gene encodes a neuron-specific RNA-binding protein, a member of the Nova family of paraneoplastic disease antigens, that is recognized and inhibited by paraneoplastic antibodies. These antibodies are found in the sera of patients with paraneoplastic opsoclonus-ataxia, breast cancer, and small cell lung cancer. Alternatively spliced transcripts encoding distinct isoforms have been described. |
Protein Interactions |
SRPK1; APP; PCBP1; RPP14; NOVA1; SMARCC2; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-NOVA1 (ARP40397_P050) antibody |
Blocking Peptide |
For anti-NOVA1 (ARP40397_P050) antibody is Catalog # AAP40397 (Previous Catalog # AAPP22141) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human NOVA1 |
Uniprot ID |
P51513 |
Protein Name |
RNA-binding protein Nova-1 |
Protein Accession # |
NP_002506 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_002515 |
Tested Species Reactivity |
Human |
Gene Symbol |
NOVA1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93% |
Image 1 | Human HeLa
| WB Suggested Anti-NOVA1 Antibody Titration: 0.2-1 ug/ml Positive Control: Hela cell lysate |
|
Image 2 | Human Adult Placenta
| Host: Rabbit Target Name: NOVA1 Sample Type: Human Adult Placenta Antibody Dilution: 1.0ug/ml |
|