NOVA1 Antibody - C-terminal region (ARP40397_P050)

Data Sheet
 
Product Number ARP40397_P050
Product Page www.avivasysbio.com/nova1-antibody-c-terminal-region-arp40397-p050.html
Name NOVA1 Antibody - C-terminal region (ARP40397_P050)
Protein Size (# AA) 507 amino acids
Molecular Weight 52kDa
NCBI Gene Id 4857
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name NOVA alternative splicing regulator 1
Alias Symbols Nova-1
Peptide Sequence Synthetic peptide located within the following region: SKKGEFVPGTRNRKVTITGTPAATQAAQYLITQRITYEQGVRAANPQKVG
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Ratti,A., (2008) J. Biol. Chem. 283 (12), 7531-7541
Description of Target NOVA1 is a neuron-specific RNA-binding protein, a member of the Nova family of paraneoplastic disease antigens, that is recognized and inhibited by paraneoplastic antibodies. These antibodies are found in the sera of patients with paraneoplastic opsoclonus-ataxia, breast cancer, and small cell lung cancer.This gene encodes a neuron-specific RNA-binding protein, a member of the Nova family of paraneoplastic disease antigens, that is recognized and inhibited by paraneoplastic antibodies. These antibodies are found in the sera of patients with paraneoplastic opsoclonus-ataxia, breast cancer, and small cell lung cancer. Alternatively spliced transcripts encoding distinct isoforms have been described.
Protein Interactions SRPK1; APP; PCBP1; RPP14; NOVA1; SMARCC2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-NOVA1 (ARP40397_P050) antibody
Blocking Peptide For anti-NOVA1 (ARP40397_P050) antibody is Catalog # AAP40397 (Previous Catalog # AAPP22141)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human NOVA1
Uniprot ID P51513
Protein Name RNA-binding protein Nova-1
Protein Accession # NP_002506
Purification Affinity Purified
Nucleotide Accession # NM_002515
Tested Species Reactivity Human
Gene Symbol NOVA1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Image 1
Human HeLa
WB Suggested Anti-NOVA1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Hela cell lysate
Image 2
Human Adult Placenta
Host: Rabbit
Target Name: NOVA1
Sample Type: Human Adult Placenta
Antibody Dilution: 1.0ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com