ACO1 Antibody - N-terminal region (ARP40390_P050)

Data Sheet
 
Product Number ARP40390_P050
Product Page www.avivasysbio.com/aco1-antibody-n-terminal-region-arp40390-p050.html
Name ACO1 Antibody - N-terminal region (ARP40390_P050)
Protein Size (# AA) 889 amino acids
Molecular Weight 98kDa
NCBI Gene Id 48
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Aconitase 1, soluble
Description
Alias Symbols IRP1, ACONS, HEL60, IREB1, IREBP, IREBP1
Peptide Sequence Synthetic peptide located within the following region: MSNPFAHLAEPLDPVQPGKKFFNLNKLEDSRYGRLPFSIRVLLEAAIRNC
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Clarke,S.L., (2006) EMBO J. 25 (3), 544-553
Description of Target ACO1, also known as iron regulatory element binding protein 1 (IREB1), is a cytosolic protein which binds to iron-responsive elements (IREs). It plays a central role in cellular iron homeostasis. It was also shown to have aconitase activity, and hence grouped with the aconitase family of enzymes.Aconitase 1, also known as iron regulatory element binding protein 1 (IREB1), is a cytosolic protein which binds to iron-responsive elements (IREs). IREs are stem-loop structures found in the 5' UTR of ferritin mRNA, and in the 3' UTR of transferrin receptor mRNA. The iron-induced binding to the IRE results in repression of translation of ferritin mRNA, and inhibition of degradation of the otherwise rapidly degrading transferrin receptor mRNA. Thus, IREB1 plays a central role in cellular iron homeostasis. It was also shown to have aconitase activity, and hence grouped with the aconitase family of enzymes.
Protein Interactions UBC; FBXL5; DCPS; STRAP; FUBP1; PSMG1; HIST1H2AB; LGALS1; CTPS1; C12orf57; APP; AKT1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ACO1 (ARP40390_P050) antibody
Blocking Peptide For anti-ACO1 (ARP40390_P050) antibody is Catalog # AAP40390 (Previous Catalog # AAPP22134)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ACO1
Uniprot ID P28271
Protein Name Cytoplasmic aconitate hydratase
Publications

Saturated Fatty Acid Activates T Cell Inflammation Through a Nicotinamide Nucleotide Transhydrogenase (NNT)-Dependent Mechanism. Biomolecules. 9, (2019). 30823587

Protein Accession # NP_002188
Purification Affinity Purified
Nucleotide Accession # NM_002197
Tested Species Reactivity Human, Mouse
Gene Symbol ACO1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 93%; Guinea Pig: 91%; Horse: 92%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 86%; Rat: 100%
Image 1
Human capan1, HPAF
Lanes:
1. 45ug capan1 cell lysate
2. 45 ug HPAF cell lysate
Primary Antibody Dilution:
1:1000
Secondary Antibody:
Anti-Rabbit HRP
Secondary Antibody Dilution:
1:5000
Gene Name:
ACO1
Submitted by:
Dr. Pankaj Singh, UNMC, Omaha, NE
Image 2
Human Skeletal muscle
Rabbit Anti-ACO1 Antibody
Catalog Number: ARP40390
Paraffin Embedded Tissue: Human Muscle
Cellular Data: Skeletal muscle cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
Image 3
Human Capan1
Sample Type:
Human Capan1 cells (Pancreatic cancer cell line)
Primary Antibody Dilution:
1:300
Secondary Antibody:
Anti-rabbit-AlexaFluor-488
Secondary Antibody Dilution:
1:200
Color/Signal Descriptions:
ACO1: Green DAPI: Blue
Gene Name:
ACO1
Submitted by:
Dr. Pankaj Singh, UNMC, Omaha, NE
Image 4
Mouse liver
Lanes:
1. 60 ug mouse liver extract 2. 60 ug mouse liver extract 3. 60 ug mouse liver extract
Primary Antibody Dilution:
1:500
Secondary Antibody:
Anti-rabbit HRP
Secondary Antibody Dilution:
1:3000
Gene Name:
ACO1
Submitted by:
Dr. Hao Zhu, University of Kansas Medical Center
Image 5
Human kidney
WB Suggested Anti-ACO1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human kidney
Image 6
HePG2
Lane 1: 100ug HePG2 lysate
Primary Antibody Dilution:
1:1000
Secondary Antibody:
Goat anti rabbit-HRP
Secondary Antibody Dilution:
1:8000
Gene Name:
ACO1
Submitted by:
José Antonio Bárcena, University of Córdoba
Image 7
Human Ovary Tumor
Host: Rabbit
Target Name: ACO1
Sample Tissue: Human Ovary Tumor
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com