Product Number |
ARP40390_P050 |
Product Page |
www.avivasysbio.com/aco1-antibody-n-terminal-region-arp40390-p050.html |
Name |
ACO1 Antibody - N-terminal region (ARP40390_P050) |
Protein Size (# AA) |
889 amino acids |
Molecular Weight |
98kDa |
NCBI Gene Id |
48 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Aconitase 1, soluble |
Description |
|
Alias Symbols |
IRP1, ACONS, HEL60, IREB1, IREBP, IREBP1 |
Peptide Sequence |
Synthetic peptide located within the following region: MSNPFAHLAEPLDPVQPGKKFFNLNKLEDSRYGRLPFSIRVLLEAAIRNC |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Clarke,S.L., (2006) EMBO J. 25 (3), 544-553 |
Description of Target |
ACO1, also known as iron regulatory element binding protein 1 (IREB1), is a cytosolic protein which binds to iron-responsive elements (IREs). It plays a central role in cellular iron homeostasis. It was also shown to have aconitase activity, and hence grouped with the aconitase family of enzymes.Aconitase 1, also known as iron regulatory element binding protein 1 (IREB1), is a cytosolic protein which binds to iron-responsive elements (IREs). IREs are stem-loop structures found in the 5' UTR of ferritin mRNA, and in the 3' UTR of transferrin receptor mRNA. The iron-induced binding to the IRE results in repression of translation of ferritin mRNA, and inhibition of degradation of the otherwise rapidly degrading transferrin receptor mRNA. Thus, IREB1 plays a central role in cellular iron homeostasis. It was also shown to have aconitase activity, and hence grouped with the aconitase family of enzymes. |
Protein Interactions |
UBC; FBXL5; DCPS; STRAP; FUBP1; PSMG1; HIST1H2AB; LGALS1; CTPS1; C12orf57; APP; AKT1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ACO1 (ARP40390_P050) antibody |
Blocking Peptide |
For anti-ACO1 (ARP40390_P050) antibody is Catalog # AAP40390 (Previous Catalog # AAPP22134) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ACO1 |
Uniprot ID |
P28271 |
Protein Name |
Cytoplasmic aconitate hydratase |
Publications |
Saturated Fatty Acid Activates T Cell Inflammation Through a Nicotinamide Nucleotide Transhydrogenase (NNT)-Dependent Mechanism. Biomolecules. 9, (2019). 30823587 |
Protein Accession # |
NP_002188 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_002197 |
Tested Species Reactivity |
Human, Mouse |
Gene Symbol |
ACO1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 93%; Guinea Pig: 91%; Horse: 92%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 86%; Rat: 100% |
Image 1 | Human capan1, HPAF
| Lanes: 1. 45ug capan1 cell lysate 2. 45 ug HPAF cell lysate Primary Antibody Dilution: 1:1000 Secondary Antibody: Anti-Rabbit HRP Secondary Antibody Dilution: 1:5000 Gene Name: ACO1 Submitted by: Dr. Pankaj Singh, UNMC, Omaha, NE
|
|
Image 2 | Human Skeletal muscle
| Rabbit Anti-ACO1 Antibody Catalog Number: ARP40390 Paraffin Embedded Tissue: Human Muscle Cellular Data: Skeletal muscle cells Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X |
|
Image 3 | Human Capan1
| Sample Type: Human Capan1 cells (Pancreatic cancer cell line)Primary Antibody Dilution: 1:300Secondary Antibody: Anti-rabbit-AlexaFluor-488Secondary Antibody Dilution: 1:200Color/Signal Descriptions: ACO1: Green DAPI: BlueGene Name: ACO1Submitted by: Dr. Pankaj Singh, UNMC, Omaha, NE |
|
Image 4 | Mouse liver
| Lanes: 1. 60 ug mouse liver extract 2. 60 ug mouse liver extract 3. 60 ug mouse liver extract Primary Antibody Dilution: 1:500 Secondary Antibody: Anti-rabbit HRP Secondary Antibody Dilution: 1:3000 Gene Name: ACO1 Submitted by: Dr. Hao Zhu, University of Kansas Medical Center
|
|
Image 5 | Human kidney
| WB Suggested Anti-ACO1 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: Human kidney |
|
Image 6 | HePG2
| Lane 1: 100ug HePG2 lysate Primary Antibody Dilution: 1:1000 Secondary Antibody: Goat anti rabbit-HRP Secondary Antibody Dilution: 1:8000 Gene Name: ACO1 Submitted by: José Antonio Bárcena, University of Córdoba |
|
Image 7 | Human Ovary Tumor
| Host: Rabbit Target Name: ACO1 Sample Tissue: Human Ovary Tumor Antibody Dilution: 1ug/ml |
|