EIF4A2 Antibody - N-terminal region (ARP40376_P050)

Data Sheet
 
Product Number ARP40376_P050
Product Page www.avivasysbio.com/eif4a2-antibody-n-terminal-region-arp40376-p050.html
Name EIF4A2 Antibody - N-terminal region (ARP40376_P050)
Protein Size (# AA) 407 amino acids
Molecular Weight 45kDa
NCBI Gene Id 1974
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Eukaryotic translation initiation factor 4A2
Alias Symbols DDX2B, EIF4A, EIF4F, BM-010, eIF4A-II, eIF-4A-II
Peptide Sequence Synthetic peptide located within the following region: MSGGSADYNREHGGPEGMDPDGVIESNWNEIVDNFDDMNLKESLLRGIYA
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Sarkar,M., (2005) FEBS Lett. 579 (16), 3449-3460
Description of Target EIF4A2 contains 1 helicase C-terminal domain and 1 helicase ATP-binding domain. It belongs to the DEAD box helicase family. eIF4A subfamily. In the current model of translation initiation, eIF4A unwinds RNA secondary structures in the 5' untranslated region of mRNAs which is necessary to allow efficient binding of the small ribosomal subunit, and subsequent scanning for the initiator codon.
Protein Interactions SLC16A9; PIH1D2; SSX2IP; TRIM39; TRIM36; DPPA4; IPO11; PDCD4; MDFI; EIF4A2; SUMO2; SUMO3; UBC; BAG3; CD81; VCP; ECT2; BRCA1; EIF4G3; DDX39B; EIF4A1; SUMO1; TK1; PFDN1; NEK2; Eif3a; CD4; RPAP2; EIF3F; EIF4G2; EIF4G1; CLNS1A; RPS29; CMBL; VAC14; EIF3L; EIF3
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-EIF4A2 (ARP40376_P050) antibody
Blocking Peptide For anti-EIF4A2 (ARP40376_P050) antibody is Catalog # AAP40376 (Previous Catalog # AAPP22120)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human EIF4A2
Uniprot ID Q14240
Protein Name Eukaryotic initiation factor 4A-II
Protein Accession # NP_001958
Purification Affinity Purified
Nucleotide Accession # NM_001967
Tested Species Reactivity Human
Gene Symbol EIF4A2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Image 1
Human Jurkat
WB Suggested Anti-EIF4A2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com