Product Number |
ARP40374_P050 |
Product Page |
www.avivasysbio.com/auh-antibody-c-terminal-region-arp40374-p050.html |
Name |
AUH Antibody - C-terminal region (ARP40374_P050) |
Protein Size (# AA) |
339 amino acids |
Molecular Weight |
37kDa |
NCBI Gene Id |
549 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
AU RNA binding protein/enoyl-CoA hydratase |
Peptide Sequence |
Synthetic peptide located within the following region: IGMSLAKELIFSARVLDGKEAKAVGLISHVLEQNQEGDAAYRKALDLARE |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Illsinger,S., (2004) Int. J. Immunogenet. 30 (3), 213-215 |
Description of Target |
AU-specific RNA-binding enoyl-CoA hydratase (AUH) protein binds to the AU-rich element (ARE), a common element found in the 3' UTR of rapidly decaying mRNA such as c-fos, c-myc and granulocyte/ macrophage colony stimulating factor. ARE elements are involved in directing RNA to rapid degradation and deadenylation. AUH is also homologous to enol-CoA hydratase, an enzyme involved in fatty acid degradation, and has been shown to have intrinsic hydratase enzymatic activity. AUH is thus a bifunctional chimera between RNA binding and metabolic enzyme activity. A possible subcellular localization in the mitochondria has been demonstrated for the mouse homolog of this protein which shares 92% identity with the human protein. It has been suggested that AUH may have a novel role as a mitochondrial located AU-binding protein. Human AUH is expressed as a single mRNA species of 1.8 kb, and translated as a 40-kDa precursor protein which is subsequently processed to a 32-kDa mature form.AU-specific RNA-binding enoyl-CoA hydratase (AUH) protein binds to the AU-rich element (ARE), a common element found in the 3' UTR of rapidly decaying mRNA such as c-fos, c-myc and granulocyte/ macrophage colony stimulating factor. ARE elements are involved in directing RNA to rapid degradation and deadenylation. AUH is also homologous to enol-CoA hydratase, an enzyme involved in fatty acid degradation, and has been shown to have intrinsic hydratase enzymatic activity. AUH is thus a bifunctional chimera between RNA binding and metabolic enzyme activity. A possible subcellular localization in the mitochondria has been demonstrated for the mouse homolog of this protein which shares 92% identity with the human protein. It has been suggested that AUH may have a novel role as a mitochondrial located AU-binding protein. Human AUH is expressed as a single mRNA species of 1.8 kb, and translated as a 40-kDa precursor protein which is subsequently processed to a 32-kDa mature form. |
Protein Interactions |
UBC; AUH; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-AUH (ARP40374_P050) antibody |
Blocking Peptide |
For anti-AUH (ARP40374_P050) antibody is Catalog # AAP40374 (Previous Catalog # AAPP22118) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human AUH |
Uniprot ID |
Q13825 |
Protein Name |
Methylglutaconyl-CoA hydratase, mitochondrial |
Sample Type Confirmation |
AUH is supported by BioGPS gene expression data to be expressed in HepG2 |
Protein Accession # |
NP_001689 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_001698 |
Tested Species Reactivity |
Human |
Gene Symbol |
AUH |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 75% |
Image 1 | Human Kidney
| Rabbit Anti-AUH Antibody Catalog Number: ARP40374 Paraffin Embedded Tissue: Human Kidney Cellular Data: Epithelial cells of renal tubule Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X |
|
Image 2 | Human HepG2
| WB Suggested Anti-AUH Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: HepG2 cell lysateAUH is supported by BioGPS gene expression data to be expressed in HepG2 |
|