website statistics
Product Datasheet: ARP40367_T100 - HNRPL antibody - N-terminal region (ARP40367_T100) - Aviva Systems Biology
HNRPL antibody - N-terminal region (ARP40367_T100)
Data Sheet
Product Number ARP40367_T100
Product Page
Product Name HNRPL antibody - N-terminal region (ARP40367_T100)
Size 100 ul
Gene Symbol HNRNPL
Alias Symbols P/OKcl.14, hnRNP-L, HNRPL
Protein Size (# AA) 589 amino acids
Molecular Weight 65kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 3191
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Heterogeneous nuclear ribonucleoprotein L
Description This is a rabbit polyclonal antibody against HNRPL. It was validated on Western Blot and immunohistochemistry by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (
Peptide Sequence Synthetic peptide located within the following region: RRRSGAMVKMAAAGGGGGGGRYYGGGSEGGRAPKRLKTDNAGDQHGGGGG
Target Reference Guang,S., (2005) Mol. Cell. Biol. 25 (15), 6303-6313
Description of Target Heterogeneous nuclear RNAs (hnRNAs) which include mRNA precursors and mature mRNAs are associated with specific proteins to form heterogenous ribonucleoprotein (hnRNP) complexes. Heterogeneous nuclear ribonucleoprotein L is among the proteins that are stably associated with hnRNP complexes and along with other hnRNP proteins is likely to play a major role in the formation, packaging, processing, and function of mRNA. Heterogeneous nuclear ribonucleoprotein L is present in the nucleoplasm as part of the HNRP complex. HNRP proteins have also been identified outside of the nucleoplasm. Exchange of hnRNP for mRNA-binding proteins accompanies transport of mRNA from the nucleus to the cytoplasm. Since HNRP proteins have been shown to shuttle between the nucleus and the cytoplasm, it is possible that they also have cytoplasmic functions. Two transcript variants encoding different isoforms have been found for this gene. Heterogeneous nuclear RNAs (hnRNAs) which include mRNA precursors and mature mRNAs are associated with specific proteins to form heterogenous ribonucleoprotein (hnRNP) complexes. Heterogeneous nuclear ribonucleoprotein L is among the proteins that are stably associated with hnRNP complexes and along with other hnRNP proteins is likely to play a major role in the formation, packaging, processing, and function of mRNA. Heterogeneous nuclear ribonucleoprotein L is present in the nucleoplasm as part of the HNRP complex. HNRP proteins have also been identified outside of the nucleoplasm. Exchange of hnRNP for mRNA-binding proteins accompanies transport of mRNA from the nucleus to the cytoplasm. Since HNRP proteins have been shown to shuttle between the nucleus and the cytoplasm, it is possible that they also have cytoplasmic functions. Two transcript variants encoding different isoforms have been found for this gene.Heterogeneous nuclear RNAs (hnRNAs) which include mRNA precursors and mature mRNAs are associated with specific proteins to form heterogenous ribonucleoprotein (hnRNP) complexes. Heterogeneous nuclear ribonucleoprotein L is among the proteins that are stably associated with hnRNP complexes and along with other hnRNP proteins is likely to play a major role in the formation, packaging, processing, and function of mRNA. Heterogeneous nuclear ribonucleoprotein L is present in the nucleoplasm as part of the HNRP complex. HNRP proteins have also been identified outside of the nucleoplasm. Exchange of hnRNP for mRNA-binding proteins accompanies transport of mRNA from the nucleus to the cytoplasm. Since HNRP proteins have been shown to shuttle between the nucleus and the cytoplasm, it is possible that they also have cytoplasmic functions. Two transcript variants encoding different isoforms have been found for this gene.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-HNRNPL (ARP40367_T100) antibody is Catalog # AAP40367 (Previous Catalog # AAPP23492)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human HNRPL
Complete computational species homology data Anti-HNRPL (ARP40367_T100)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express HNRPL.
Swissprot Id P14866
Protein Name Heterogeneous nuclear ribonucleoprotein L
Sample Type Confirmation

HNRNPL is strongly supported by BioGPS gene expression data to be expressed in Jurkat

Protein Accession # NP_001524
Purification Protein A purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express HNRPL.
Nucleotide Accession # NM_001533
Replacement Item This antibody may replace item sc-16550 from Santa Cruz Biotechnology.
Conjugation Options

ARP40367_T100-FITC Conjugated

ARP40367_T100-HRP Conjugated

ARP40367_T100-Biotin Conjugated

CB Replacement sc-16550; sc-28726; sc-30720; sc-32317; sc-393737; sc-46673; sc-48391
Species Reactivity Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 92%; Yeast: 85%; Zebrafish: 79%
Image 1
Human Kidney
Rabbit Anti-HNRPL Antibody
Catalog Number: ARP40367
Paraffin Embedded Tissue: Human Kidney
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
Image 2
Human Jurkat
WB Suggested Anti-HNRPL Antibody Titration: 1.25ug/ml
Positive Control: Jurkat cell lysate

HNRNPL is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells


AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 |