CSH1 Antibody - middle region (ARP40350_T100)

• Product Number: ARP40350_T100
• Name: CSH1 Antibody - middle region (ARP40350_T100)
• Protein Size (# AA): 217 amino acids
• Molecular Weight: 24kDa
• NCBI Gene Id: 1442
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Chorionic somatomammotropin hormone 1 (placental lactogen)
• Alias Symbols: PL, CSA, CS-1, CSMT, GHB3, hCS-1, hCS-A
• Peptide Sequence: Synthetic peptide located within the following region: SMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYS
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Walsh,S.T. (2006) J. Mol. Biol. 358 (3), 773-784
• Description of Target: CSH1 is a member of the somatotropin/prolactin family of hormones and plays an important role in growth control. This particular family member is expressed mainly in the placenta and utilizes multiple transcription initiation sites. Expression of the identical mature proteins for chorionic somatomammotropin hormones 1 and 2 is upregulated during development, although the ratio of 1 to 2 increases by term. Mutations in this gene result in placental lactogen deficiency and Silver-Russell syndrome.The protein encoded by this gene is a member of the somatotropin/prolactin family of hormones and plays an important role in growth control. The gene is located at the growth hormone locus on chromosome 17 along with four other related genes in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. Although the five genes share a remarkably high degree of sequence identity, they are expressed selectively in different tissues. Alternative splicing generates additional isoforms of each of the five growth hormones, leading to further diversity and potential for specialization. This particular family member is expressed mainly in the placenta and utilizes multiple transcription initiation sites. Expression of the identical mature proteins for chorionic somatomammotropin hormones 1 and 2 is upregulated during development, although the ratio of 1 to 2 increases by term. Mutations in this gene result in placental lactogen deficiency and Silver-Russell syndrome.
• Protein Interactions: PSMD9; PTPN12; SMAD9; SMAD4; SMAD2; PRLR; POLR2A; SMAD3;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-CSH1 (ARP40350_T100) antibody is Catalog # AAP40350 (Previous Catalog # AAPP10387)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CSH1
• Uniprot ID: P01243
• Protein Name: Chorionic somatomammotropin hormone
• Protein Accession #: NP_001308
• Purification: Protein A purified
• Nucleotide Accession #: NM_001317
• Tested Species Reactivity: Human
• Gene Symbol: CSH1
• Predicted Species Reactivity: Human, Rat, Dog, Guinea Pig, Rabbit
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Dog: 100%; Guinea Pig: 100%; Human: 100%; Rabbit: 100%; Rat: 100%
• Image 1: Human Placenta
  
  WB Suggested Anti-CSH1 Antibody Titration: 1.25ug/ml
  ELISA Titer: 1:312500
  Positive Control: Human Placenta
• Image 2: Human Stomach
  
  Rabbit Anti-CSH1 Antibody
  Catalog Number: ARP40350
  Paraffin Embedded Tissue: Human Stomach
  Cellular Data: Epithelial cells of fundic gland
  Antibody Concentration: 4.0-8.0 ug/ml
  Magnification: 400X