| Product Number |
ARP40342_T100 |
| Product Page |
www.avivasysbio.com/adarb1-antibody-n-terminal-region-arp40342-t100.html |
| Name |
ADARB1 Antibody - N-terminal region (ARP40342_T100) |
| Protein Size (# AA) |
701 amino acids |
| Molecular Weight |
77kDa |
| NCBI Gene Id |
104 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Adenosine deaminase, RNA-specific, B1 |
| Description |
|
| Alias Symbols |
RED1, ADAR2, DRABA2, DRADA2, NEDHYMS |
| Peptide Sequence |
Synthetic peptide located within the following region: QLSNGGGGGPGRKRPLEEGSNGHSKYRLKKRRKTPGPVLPKNALMQLNEI |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Kawahara,Y., Gene 363, 193-201 (2005) |
| Description of Target |
ADARB1 is an enzyme responsible for pre-mRNA editing of the glutamate receptor subunit B by site-specific deamination of adenosines. Studies in rat found that this enzyme acted on its own pre-mRNA molecules to convert an AA dinucleotide to an AI dinucleotide which resulted in a new splice site.This gene encodes the enzyme responsible for pre-mRNA editing of the glutamate receptor subunit B by site-specific deamination of adenosines. Studies in rat found that this enzyme acted on its own pre-mRNA molecules to convert an AA dinucleotide to an AI dinucleotide which resulted in a new splice site. Alternative splicing of this gene results in several transcript variants, some of which have been characterized by the presence or absence of an ALU cassette insert and a short or long C-terminal region. |
| Protein Interactions |
EBNA1BP2; IFRD2; CCDC124; NIFK; C7orf50; C1orf35; STRBP; BRIX1; SDAD1; ZFR; NOP16; MRTO4; RRS1; BMI1; APP; UBC; PPP2CB; WWP2; PIN1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ADARB1 (ARP40342_T100) antibody |
| Blocking Peptide |
For anti-ADARB1 (ARP40342_T100) antibody is Catalog # AAP40342 (Previous Catalog # AAPP10379) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ADARB1 |
| Uniprot ID |
Q4AE79 |
| Protein Name |
Double-stranded RNA-specific editase 1 |
| Publications |
Spellman, C., Ahmed, M. M., Dubach, D. & Gardiner, K. J. Expression of trisomic proteins in Down syndrome model systems. Gene 512, 219-225 (2013). 23103828
The GABAAα5-selective Modulator, RO4938581, Rescues Protein Anomalies in the Ts65Dn Mouse Model of Down Syndrome. Neuroscience. 372, 192-212 (2018) 29292072 |
| Protein Accession # |
NP_001103 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_001112 |
| Tested Species Reactivity |
Human, Mouse |
| Gene Symbol |
ADARB1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 83%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 92% |
| Image 1 | Mouse brains
 | ADARB1 antibody - N-terminal region (ARP40342_T100) validated by WB using Mouse brains at 1:1000. |
|
| Image 2 | Human HepG2
 | WB Suggested Anti-ADARB1 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2 cell lysate |
|
