| Product Number |
ARP40336_T100 |
| Product Page |
www.avivasysbio.com/pum3-antibody-n-terminal-region-arp40336-t100.html |
| Name |
PUM3 Antibody - N-terminal region (ARP40336_T100) |
| Protein Size (# AA) |
648 amino acids |
| Molecular Weight |
71kDa |
| NCBI Gene Id |
9933 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
pumilio RNA binding family member 3 |
| Alias Symbols |
PEN, HA-8, PUF6, XTP5, PUF-A, HLA-HA8, KIAA0020 |
| Peptide Sequence |
Synthetic peptide located within the following region: GKKGVKQFKNKQQGDKSPKNKFQPANKFNKKRKFQPDGRSDESAAKKPKW |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Warren,E.H., (2002) Tissue Antigens 59 (4), 293-303 |
| Protein Interactions |
UBC; RNF2; EED; CUL3; SIRT7; SUMO2; SUMO1; CALM1; tat; HPS6; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-PUM3 (ARP40336_T100) antibody |
| Blocking Peptide |
For anti-PUM3 (ARP40336_T100) antibody is Catalog # AAP40336 (Previous Catalog # AAPP10373) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human KIAA0020 |
| Uniprot ID |
Q15397 |
| Protein Name |
pumilio homolog 3 |
| Sample Type Confirmation |
KIAA0020 is supported by BioGPS gene expression data to be expressed in HepG2 |
| Protein Accession # |
NP_001026861 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_001031691 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
PUM3 |
| Predicted Species Reactivity |
Human, Rat, Cow, Dog, Guinea Pig, Pig, Rabbit |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 93%; Guinea Pig: 79%; Human: 100%; Pig: 93%; Rabbit: 79%; Rat: 86% |
| Image 1 | Human Lung
 | Catalog Number: ARP40336
Paraffin Embedded Tissue: Human Lung
Cellular Data: Alveolar cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X |
|
| Image 2 | Human HepG2
 | WB Suggested Anti-KIAA0020 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysateKIAA0020 is supported by BioGPS gene expression data to be expressed in HepG2 |
|
| Image 3 | Human Lung
 | Rabbit Anti-KIAA0020 Antibody
Catalog Number: ARP40336
Paraffin Embedded Tissue: Human alveolar cell
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X |
|
