Product Number |
ARP40322_T100 |
Product Page |
www.avivasysbio.com/rps14-antibody-middle-region-arp40322-t100.html |
Name |
RPS14 Antibody - middle region (ARP40322_T100) |
Protein Size (# AA) |
151 amino acids |
Molecular Weight |
17kDa |
NCBI Gene Id |
6208 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Ribosomal protein S14 |
Alias Symbols |
S14, EMTB |
Peptide Sequence |
Synthetic peptide located within the following region: GNRTKTPGPGAQSALRALARSGMKIGRIEDVTPIPSDSTRRKGGRRGRRL |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Kenmochi,N., (1998) Genome Res. 8 (5), 509-523 |
Description of Target |
Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. RPS14 is a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S11P family of ribosomal proteins. It is located in the cytoplasm. In Chinese hamster ovary cells, mutations in this gene can lead to resistance to emetine, a protein synthesis inhibitor.Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S11P family of ribosomal proteins. It is located in the cytoplasm. Transcript variants utilizing alternative transcription initiation sites have been described in the literature. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. In Chinese hamster ovary cells, mutations in this gene can lead to resistance to emetine, a protein synthesis inhibitor. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene. |
Protein Interactions |
FUS; TAF9; HUWE1; CEP76; TUBG1; CEP250; TUBGCP3; CEP57; TP53; AURKA; UBC; MDM2; ZBTB1; EED; WIBG; TSR1; SERBP1; LARP1; RPS29; RPS28; RPS27; RPS26; RPS25; RPS24; RPS23; RPS20; RPS19; RPS18; RPS16; RPS15A; RPS13; RPS12; RPS10; RPS9; RPS8; RPS7; RPS6; RPS5; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-RPS14 (ARP40322_T100) antibody |
Blocking Peptide |
For anti-RPS14 (ARP40322_T100) antibody is Catalog # AAP40322 (Previous Catalog # AAPP10359) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human RPS14 |
Uniprot ID |
P62263 |
Protein Name |
40S ribosomal protein S14 |
Sample Type Confirmation |
RPS14 is strongly supported by BioGPS gene expression data to be expressed in 721_B RPS14 is supported by BioGPS gene expression data to be expressed in HeLa, Jurkat, MCF7 |
Protein Accession # |
NP_001020242 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_001025071 |
Tested Species Reactivity |
Human |
Gene Symbol |
RPS14 |
Predicted Species Reactivity |
Human, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 93%; Zebrafish: 100% |
Image 1 | Human HepG2
| WB Suggested Anti-RPS14 Antibody Titration: 2.5ug/ml ELISA Titer: 1:12500 Positive Control: HepG2 cell lysate |
|
Image 2 | Human Jurkat
| Host: Rabbit Target Name: RPS14 Sample Type: Jurkat Antibody Dilution: 1.0ug/mlRPS14 is supported by BioGPS gene expression data to be expressed in Jurkat |
|
Image 3 | Human MCF7
| Host: Rabbit Target Name: RPS14 Sample Type: MCF7 Antibody Dilution: 1.0ug/mlRPS14 is supported by BioGPS gene expression data to be expressed in MCF7 |
|
Image 4 | Human Hela
| Host: Rabbit Target Name: RPS14 Sample Type: Hela Antibody Dilution: 1.0ug/mlRPS14 is supported by BioGPS gene expression data to be expressed in HeLa |
|
Image 5 | Human Fetal Lung
| Host: Rabbit Target Name: RPS14 Sample Type: Human Fetal Lung Antibody Dilution: 1.0ug/ml |
|
Image 6 | Human Fetal Liver
| Host: Rabbit Target Name: RPS14 Sample Type: Human Fetal Liver Antibody Dilution: 1.0ug/ml |
|
Image 7 | Human Fetal Brain
| Host: Rabbit Target Name: RPS14 Sample Type: Human Fetal Brain Antibody Dilution: 1.0ug/ml |
|
Image 8 | Human 721_B
| Host: Rabbit Target Name: RPS14 Sample Type: 721_B Antibody Dilution: 1.0ug/mlRPS14 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells |
|