RPS14 Antibody - middle region (ARP40322_T100)

Data Sheet
 
Product Number ARP40322_T100
Product Page www.avivasysbio.com/rps14-antibody-middle-region-arp40322-t100.html
Name RPS14 Antibody - middle region (ARP40322_T100)
Protein Size (# AA) 151 amino acids
Molecular Weight 17kDa
NCBI Gene Id 6208
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Ribosomal protein S14
Alias Symbols S14, EMTB
Peptide Sequence Synthetic peptide located within the following region: GNRTKTPGPGAQSALRALARSGMKIGRIEDVTPIPSDSTRRKGGRRGRRL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Kenmochi,N., (1998) Genome Res. 8 (5), 509-523
Description of Target Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. RPS14 is a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S11P family of ribosomal proteins. It is located in the cytoplasm. In Chinese hamster ovary cells, mutations in this gene can lead to resistance to emetine, a protein synthesis inhibitor.Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S11P family of ribosomal proteins. It is located in the cytoplasm. Transcript variants utilizing alternative transcription initiation sites have been described in the literature. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. In Chinese hamster ovary cells, mutations in this gene can lead to resistance to emetine, a protein synthesis inhibitor. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene.
Protein Interactions FUS; TAF9; HUWE1; CEP76; TUBG1; CEP250; TUBGCP3; CEP57; TP53; AURKA; UBC; MDM2; ZBTB1; EED; WIBG; TSR1; SERBP1; LARP1; RPS29; RPS28; RPS27; RPS26; RPS25; RPS24; RPS23; RPS20; RPS19; RPS18; RPS16; RPS15A; RPS13; RPS12; RPS10; RPS9; RPS8; RPS7; RPS6; RPS5;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-RPS14 (ARP40322_T100) antibody
Blocking Peptide For anti-RPS14 (ARP40322_T100) antibody is Catalog # AAP40322 (Previous Catalog # AAPP10359)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human RPS14
Uniprot ID P62263
Protein Name 40S ribosomal protein S14
Sample Type Confirmation

RPS14 is strongly supported by BioGPS gene expression data to be expressed in 721_B

RPS14 is supported by BioGPS gene expression data to be expressed in HeLa, Jurkat, MCF7

Protein Accession # NP_001020242
Purification Protein A purified
Nucleotide Accession # NM_001025071
Tested Species Reactivity Human
Gene Symbol RPS14
Predicted Species Reactivity Human, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 93%; Zebrafish: 100%
Image 1
Human HepG2
WB Suggested Anti-RPS14 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:12500
Positive Control: HepG2 cell lysate
Image 2
Human Jurkat
Host: Rabbit
Target Name: RPS14
Sample Type: Jurkat
Antibody Dilution: 1.0ug/mlRPS14 is supported by BioGPS gene expression data to be expressed in Jurkat
Image 3
Human MCF7
Host: Rabbit
Target Name: RPS14
Sample Type: MCF7
Antibody Dilution: 1.0ug/mlRPS14 is supported by BioGPS gene expression data to be expressed in MCF7
Image 4
Human Hela
Host: Rabbit
Target Name: RPS14
Sample Type: Hela
Antibody Dilution: 1.0ug/mlRPS14 is supported by BioGPS gene expression data to be expressed in HeLa
Image 5
Human Fetal Lung
Host: Rabbit
Target Name: RPS14
Sample Type: Human Fetal Lung
Antibody Dilution: 1.0ug/ml
Image 6
Human Fetal Liver
Host: Rabbit
Target Name: RPS14
Sample Type: Human Fetal Liver
Antibody Dilution: 1.0ug/ml
Image 7
Human Fetal Brain
Host: Rabbit
Target Name: RPS14
Sample Type: Human Fetal Brain
Antibody Dilution: 1.0ug/ml
Image 8
Human 721_B
Host: Rabbit
Target Name: RPS14
Sample Type: 721_B
Antibody Dilution: 1.0ug/mlRPS14 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com