RAE1 Antibody - C-terminal region (ARP40301_P050)

• Product Number: ARP40301_P050
• Name: RAE1 Antibody - C-terminal region (ARP40301_P050)
• Protein Size (# AA): 368 amino acids
• Molecular Weight: 40kDa
• NCBI Gene Id: 8480
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: RAE1 RNA export 1 homolog (S. pombe)
• Alias Symbols: Gle2, MIG14, MRNP41, Mnrp41, dJ481F12.3, dJ800J21.1
• Peptide Sequence: Synthetic peptide located within the following region: EQLDQPISACCFNHNGNIFAYASSYDWSKGHEFYNPQKKNYIFLRNAAEE
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Blower,M.D., (2005) Cell 121 (2), 223-234
• Description of Target: RAE1 is a homolog of yeast Rae1. It contains four WD40 motifs, and has been shown to localize to distinct foci in the nucleoplasm, to the nuclear rim, and to meshwork-like structures throughout the cytoplasm. This gene is thought to be involved in nucleocytoplasmic transport, and in directly or indirectly attaching cytoplasmic mRNPs to the cytoskeleton.Mutations in the Schizosaccharomyces pombe Rae1 and Saccharomyces cerevisiae Gle2 genes have been shown to result in accumulation of poly(A)-containing mRNA in the nucleus, suggesting that the encoded proteins are involved in RNA export. The protein encoded by this gene is a homolog of yeast Rae1. It contains four WD40 motifs, and has been shown to localize to distinct foci in the nucleoplasm, to the nuclear rim, and to meshwork-like structures throughout the cytoplasm. This gene is thought to be involved in nucleocytoplasmic transport, and in directly or indirectly attaching cytoplasmic mRNPs to the cytoskeleton. Alternatively spliced transcript variants encoding the same protein have been found for this gene.
• Protein Interactions: TP53; CDC37; DGCR8; YAP1; STK3; EEF2K; SOX2; HNRNPUL1; YWHAQ; UBC; FN1; ZC3HAV1; UBD; DDX39B; NUP98; MAP2; NUMA1; RNA28S5; RNA18S5; LSM14A; IGF2BP3; NXF1; TACC3; DYNLL1; KHSRP; KPNB1; ILF3; COPS6; CUL1; CUL3; Nup214; Nup188; KAT2A; PTTG1; POLR3H; FAM122B;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-RAE1 (ARP40301_P050) antibody is Catalog # AAP40301 (Previous Catalog # AAPP10338)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human RAE1
• Uniprot ID: P78406
• Protein Name: mRNA export factor
• Sample Type Confirmation:

  RAE1 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

• Protein Accession #: NP_001015885
• Purification: Affinity Purified
• Nucleotide Accession #: NM_001015885
• Tested Species Reactivity: Human
• Gene Symbol: RAE1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
• Image 1: Human Skin
  
  Immunohistochemistry with Human Skin lysate tissue at an antibody concentration of 5.0ug/ml using anti-RAE1 antibody (ARP40301_P050)
• Image 2: Human Kidney
  
  Rabbit Anti-RAE1 Antibody
  Catalog Number: ARP40301
  Paraffin Embedded Tissue: Human Kidney
  Cellular Data: Epithelial cells of renal tubule
  Antibody Concentration: 4.0-8.0 ug/ml
  Magnification: 400X
• Image 3: Human Jurkat
  
  WB Suggested Anti-RAE1 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:312500
  Positive Control: Jurkat cell lysateRAE1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells