DDX19B Antibody - C-terminal region (ARP40299_T100)

Data Sheet
 
Product Number ARP40299_T100
Product Page www.avivasysbio.com/ddx19b-antibody-c-terminal-region-arp40299-t100.html
Name DDX19B Antibody - C-terminal region (ARP40299_T100)
Protein Size (# AA) 479 amino acids
Molecular Weight 53kDa
NCBI Gene Id 11269
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name DEAD (Asp-Glu-Ala-Asp) box polypeptide 19B
Alias Symbols DBP5, RNAh, DDX19
Peptide Sequence Synthetic peptide located within the following region: GKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNETYLHRIGRTG
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Yin,L., Reprod. Fertil. Dev. 14 (3-4), 185-189 (2002)
Description of Target DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DDX19B is a DEAD box protein, which exhibits RNA-dependent ATPase and ATP-dependent RNA-unwinding activities. This protein is recruited to the cytoplasmic fibrils of the nuclear pore complex, where it participates in the export of mRNA from the nucleus.DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, which exhibits RNA-dependent ATPase and ATP-dependent RNA-unwinding activities. This protein is recruited to the cytoplasmic fibrils of the nuclear pore complex, where it participates in the export of mRNA from the nucleus. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Protein Interactions MIF4GD; UBC; CTBP2; AICDA; APP; COPS5; POT1; TERF1; tat; IKBKG; RAE1; RWDD2B; XPO7; B3GALT4; SKP1; PRPSAP1; GNB2L1; DCK; NUP214; KLHDC2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-DDX19B (ARP40299_T100) antibody
Blocking Peptide For anti-DDX19B (ARP40299_T100) antibody is Catalog # AAP40299 (Previous Catalog # AAPP22805)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human DDX19B
Uniprot ID Q9UMR2
Protein Name ATP-dependent RNA helicase DDX19B
Sample Type Confirmation

DDX19B is supported by BioGPS gene expression data to be expressed in HepG2

Protein Accession # NP_009173
Purification Protein A purified
Nucleotide Accession # NM_007242
Tested Species Reactivity Human
Gene Symbol DDX19B
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 79%; Zebrafish: 100%
Image 1
Human HepG2
WB Suggested Anti-DDX19B Antibody Titration: 2.5ug/ml
Positive Control: HepG2 cell lysateDDX19B is supported by BioGPS gene expression data to be expressed in HepG2
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com