Product Number |
ARP40299_T100 |
Product Page |
www.avivasysbio.com/ddx19b-antibody-c-terminal-region-arp40299-t100.html |
Name |
DDX19B Antibody - C-terminal region (ARP40299_T100) |
Protein Size (# AA) |
479 amino acids |
Molecular Weight |
53kDa |
NCBI Gene Id |
11269 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
DEAD (Asp-Glu-Ala-Asp) box polypeptide 19B |
Alias Symbols |
DBP5, RNAh, DDX19 |
Peptide Sequence |
Synthetic peptide located within the following region: GKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNETYLHRIGRTG |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Yin,L., Reprod. Fertil. Dev. 14 (3-4), 185-189 (2002) |
Description of Target |
DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DDX19B is a DEAD box protein, which exhibits RNA-dependent ATPase and ATP-dependent RNA-unwinding activities. This protein is recruited to the cytoplasmic fibrils of the nuclear pore complex, where it participates in the export of mRNA from the nucleus.DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, which exhibits RNA-dependent ATPase and ATP-dependent RNA-unwinding activities. This protein is recruited to the cytoplasmic fibrils of the nuclear pore complex, where it participates in the export of mRNA from the nucleus. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
Protein Interactions |
MIF4GD; UBC; CTBP2; AICDA; APP; COPS5; POT1; TERF1; tat; IKBKG; RAE1; RWDD2B; XPO7; B3GALT4; SKP1; PRPSAP1; GNB2L1; DCK; NUP214; KLHDC2; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-DDX19B (ARP40299_T100) antibody |
Blocking Peptide |
For anti-DDX19B (ARP40299_T100) antibody is Catalog # AAP40299 (Previous Catalog # AAPP22805) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human DDX19B |
Uniprot ID |
Q9UMR2 |
Protein Name |
ATP-dependent RNA helicase DDX19B |
Sample Type Confirmation |
DDX19B is supported by BioGPS gene expression data to be expressed in HepG2 |
Protein Accession # |
NP_009173 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_007242 |
Tested Species Reactivity |
Human |
Gene Symbol |
DDX19B |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 79%; Zebrafish: 100% |
Image 1 | Human HepG2
| WB Suggested Anti-DDX19B Antibody Titration: 2.5ug/ml Positive Control: HepG2 cell lysateDDX19B is supported by BioGPS gene expression data to be expressed in HepG2 |
|