| Product Number |
ARP40283_P050 |
| Product Page |
www.avivasysbio.com/rp11-78j21-1-antibody-n-terminal-region-arp40283-p050.html |
| Name |
RP11-78J21.1 Antibody - N-terminal region (ARP40283_P050) |
| Protein Size (# AA) |
320 amino acids |
| Molecular Weight |
35kDa |
| NCBI Gene Id |
144983 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Heterogeneous nuclear ribonucleoprotein A1-like 2 |
| Peptide Sequence |
Synthetic peptide located within the following region: MSKSASPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPN |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Ota,T., (2004) Nat. Genet. 36 (1), 40-45 |
| Description of Target |
The function remains unknown. |
| Protein Interactions |
UBC; HCVgp1; ESR1; HNRNPA3; BZW1; RAB1A; SERPINH1; Recql4; Cep55; Cdk1; Cbx1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-HNRNPA1L2 (ARP40283_P050) antibody |
| Blocking Peptide |
For anti-HNRNPA1L2 (ARP40283_P050) antibody is Catalog # AAP40283 (Previous Catalog # AAPP22991) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human RP11-78J21.1 |
| Uniprot ID |
Q6IPF2 |
| Protein Name |
Heterogeneous nuclear ribonucleoprotein A1 EMBL AAH71945.1 |
| Sample Type Confirmation |
HNRNPA1L2 is strongly supported by BioGPS gene expression data to be expressed in Jurkat |
| Protein Accession # |
NP_001011724 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001011724 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
HNRNPA1L2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-RP11-78J21.1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysateHNRNPA1L2 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells |
|
| Image 2 | Human Skin
 | Rabbit Anti-RP11-78J21.1 Antibody
Catalog Number: ARP40283
Paraffin Embedded Tissue: Human Skin
Cellular Data: Epidermal cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X |
|
