APOBEC3F Antibody - N-terminal region (ARP40252_P050)

Data Sheet
 
Product Number ARP40252_P050
Product Page www.avivasysbio.com/apobec3f-antibody-n-terminal-region-arp40252-p050.html
Name APOBEC3F Antibody - N-terminal region (ARP40252_P050)
Protein Size (# AA) 373 amino acids
Molecular Weight 45kDa
NCBI Gene Id 200316
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3F
Alias Symbols A3F, KA6, ARP8, BK150C2.4.MRNA
Peptide Sequence Synthetic peptide located within the following region: MKPHFRNTVERMYRDTFSYNFYNRPILSRRNTVWLCYEVKTKGPSRPRLD
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Naito,E., (2008) J. Virol. 82 (11), 5636-5642
Description of Target APOBEC3F is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1. It is thought that the proteins may be RNA editing enzymes and have roles in growth or cell cycle control. Alternatively spliced transcript variants encoding different isoforms have been identified. This gene is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1. It is thought that the proteins may be RNA editing enzymes and have roles in growth or cell cycle control. Alternatively spliced transcript variants encoding different isoforms have been identified.
Protein Interactions vif; BMI1; ACD; TINF2; UBC;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-APOBEC3F (ARP40252_P050) antibody
Blocking Peptide For anti-APOBEC3F (ARP40252_P050) antibody is Catalog # AAP40252 (Previous Catalog # AAPS00601)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human APOBEC3F
Uniprot ID Q8IUX4
Protein Name DNA dC->dU-editing enzyme APOBEC-3F
Sample Type Confirmation

APOBEC3F is supported by BioGPS gene expression data to be expressed in OVCAR3

Protein Accession # NP_660341
Purification Affinity Purified
Nucleotide Accession # NM_145298
Tested Species Reactivity Human
Gene Symbol APOBEC3F
Predicted Species Reactivity Human, Pig
Application WB
Predicted Homology Based on Immunogen Sequence Human: 100%; Pig: 79%
Image 1
Human 293T Whole Cell
Host: Rabbit
Target Name: APOBEC3F
Sample Tissue: Human 293T Whole Cell
Antibody Dilution: 4ug/ml
Image 2
Human Hela Whole Cell
Host: Rabbit
Target Name: APOBEC3F
Sample Tissue: Human Hela Whole Cell
Antibody Dilution: 3ug/ml
Image 3
Human Spleen, SH-SY5Y Cell Lysate
Host: Rabbit
Target: APOBEC3F
Positive control (+): Human Spleen (SP)
Negative control (-): SH-SY5Y Cell Lysate (N19)
Antibody concentration: 1ug/ml
Image 4
Human OVCAR-3
WB Suggested Anti-APOBEC3F Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: OVCAR-3 cell lysateAPOBEC3F is supported by BioGPS gene expression data to be expressed in OVCAR3
Image 5
Human 293T Whole Cell
Host: Rabbit
Target Name: APOBEC3F
Sample Tissue: Human 293T Whole Cell
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com