DAZ2 Antibody - N-terminal region (ARP40250_P050)

• Product Number: ARP40250_P050
• Name: DAZ2 Antibody - N-terminal region (ARP40250_P050)
• Protein Size (# AA): 534 amino acids
• Molecular Weight: 59kDa
• NCBI Gene Id: 57055
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Deleted in azoospermia 2
• Alias Symbols: pDP1678
• Peptide Sequence: Synthetic peptide located within the following region: MDETEIGSCFGRYGSVKEVKIITNRTGVSKGYGFVSFVNDVDVQKIVGSQ
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Kuo,P.L., (2004) Fertil. Steril. 81 (4), 1034-1040
• Description of Target: DAZ2 is a member of the DAZ family and is a candidate for the human Y-chromosomal azoospermia factor (AZF). This RNA-binding protein is important for spermatogenesis.This gene is a member of the DAZ gene family and is a candidate for the human Y-chromosomal azoospermia factor (AZF). Its expression is restricted to premeiotic germ cells, particularly in spermatogonia. It encodes an RNA-binding protein that is important for spermatogenesis. Four copies of this gene are found on chromosome Y within palindromic duplications; one pair of genes is part of the P2 palindrome and the second pair is part of the P1 palindrome. Each gene contains a 2.4 kb repeat including a 72-bp exon, called the DAZ repeat; the number of DAZ repeats is variable and there are several variations in the sequence of the DAZ repeat. Each copy of the gene also contains a 10.8 kb region that may be amplified; this region includes five exons that encode an RNA recognition motif (RRM) domain. This gene contains one copy of the 10.8 kb repeat. Alternative splicing results in multiple transcript variants encoding different isoforms.
• Protein Interactions: UBC; PUM2;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-DAZ2 (ARP40250_P050) antibody is Catalog # AAP40250 (Previous Catalog # AAPS02809)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DAZ2
• Uniprot ID: Q2KHN6
• Protein Name: Deleted in azoospermia protein 2
• Sample Type Confirmation:

  DAZ2 is strongly supported by BioGPS gene expression data to be expressed in Daudi

• Protein Accession #: NP_001005785
• Purification: Affinity Purified
• Nucleotide Accession #: NM_001005785
• Tested Species Reactivity: Human
• Gene Symbol: DAZ2
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 93%; Goat: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%
• Image 1: Human Skin
  
  Rabbit Anti-DAZ2 Antibody
  Catalog Number: ARP40250
  Paraffin Embedded Tissue: Human Skin
  Cellular Data: Squamous epithelial cells
  Antibody Concentration: 4.0-8.0 ug/ml
  Magnification: 400X
• Image 2: Human Daudi
  
  WB Suggested Anti-DAZ2 Antibody Titration: 0.2-1 ug/ml
  Positive Control: Daudi cell lysateDAZ2 is strongly supported by BioGPS gene expression data to be expressed in Human Daudi cells