DAZ4 Antibody - N-terminal region (ARP40243_P050)

Data Sheet
 
Product Number ARP40243_P050
Product Page www.avivasysbio.com/daz4-antibody-n-terminal-region-arp40243-p050.html
Name DAZ4 Antibody - N-terminal region (ARP40243_P050)
Protein Size (# AA) 331 amino acids
Molecular Weight 36kDa
NCBI Gene Id 57135
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Deleted in azoospermia 4
Alias Symbols pDP1680, pDP1681
Peptide Sequence Synthetic peptide located within the following region: MSAANPETPNSTISREASTQSSSAAASQGWVLPEGKIVPNTVFVGGIDAR
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Fernandes S, (2003) Am J Hum Genet. 2004 Jan;74(1):180-7.
Description of Target This gene is a member of the DAZ gene family and is a candidate for the human Y-chromosomal azoospermia factor (AZF). This RNA-binding protein is important for spermatogenesis.
Protein Interactions UBC; DZIP1; PUM2; DAZL; BOLL; QKI;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-DAZ4 (ARP40243_P050) antibody
Blocking Peptide For anti-DAZ4 (ARP40243_P050) antibody is Catalog # AAP40243 (Previous Catalog # AAPP22087)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human DAZ4
Uniprot ID Q86SG3
Protein Name Deleted in azoospermia protein 4
Protein Accession # AAF91331
Purification Affinity Purified
Nucleotide Accession # NM_001005375
Tested Species Reactivity Human
Gene Symbol DAZ4
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Goat: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 92%; Rat: 100%
Image 1
Human HepG2
WB Suggested Anti-DAZ4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate
Image 2
Human Kidney
Rabbit Anti-DAZ4 Antibody
Catalog Number: ARP40243
Paraffin Embedded Tissue: Human Kidney
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
Image 3
Human Stomach
Rabbit Anti-DAZ4 Antibody
Catalog Number: ARP40243
Paraffin Embedded Tissue: Human Stomach
Cellular Data: Epithelial cells of fundic gland
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com