Product Number |
ARP40243_P050 |
Product Page |
www.avivasysbio.com/daz4-antibody-n-terminal-region-arp40243-p050.html |
Name |
DAZ4 Antibody - N-terminal region (ARP40243_P050) |
Protein Size (# AA) |
331 amino acids |
Molecular Weight |
36kDa |
NCBI Gene Id |
57135 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Deleted in azoospermia 4 |
Alias Symbols |
pDP1680, pDP1681 |
Peptide Sequence |
Synthetic peptide located within the following region: MSAANPETPNSTISREASTQSSSAAASQGWVLPEGKIVPNTVFVGGIDAR |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Fernandes S, (2003) Am J Hum Genet. 2004 Jan;74(1):180-7. |
Description of Target |
This gene is a member of the DAZ gene family and is a candidate for the human Y-chromosomal azoospermia factor (AZF). This RNA-binding protein is important for spermatogenesis. |
Protein Interactions |
UBC; DZIP1; PUM2; DAZL; BOLL; QKI; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-DAZ4 (ARP40243_P050) antibody |
Blocking Peptide |
For anti-DAZ4 (ARP40243_P050) antibody is Catalog # AAP40243 (Previous Catalog # AAPP22087) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human DAZ4 |
Uniprot ID |
Q86SG3 |
Protein Name |
Deleted in azoospermia protein 4 |
Protein Accession # |
AAF91331 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_001005375 |
Tested Species Reactivity |
Human |
Gene Symbol |
DAZ4 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Goat: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 92%; Rat: 100% |
Image 1 | Human HepG2
| WB Suggested Anti-DAZ4 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: HepG2 cell lysate |
|
Image 2 | Human Kidney
| Rabbit Anti-DAZ4 Antibody Catalog Number: ARP40243 Paraffin Embedded Tissue: Human Kidney Cellular Data: Epithelial cells of renal tubule Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X |
|
Image 3 | Human Stomach
| Rabbit Anti-DAZ4 Antibody Catalog Number: ARP40243 Paraffin Embedded Tissue: Human Stomach Cellular Data: Epithelial cells of fundic gland Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X |
|