RBMS3 antibody - C-terminal region (ARP40235_T100)
Data Sheet
 
Product Number ARP40235_T100
Product Page www.avivasysbio.com/rbms3-antibody-c-terminal-region-arp40235-t100.html
Product Name RBMS3 antibody - C-terminal region (ARP40235_T100)
Size 100 ul
Gene Symbol RBMS3
Protein Size (# AA) 419 amino acids
Molecular Weight 46kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 27303
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name RNA binding motif, single stranded interacting protein 3
Description This is a rabbit polyclonal antibody against RBMS3. It was validated on Western Blot using a cell lysate as a positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (info@avivasysbio.com).
Peptide Sequence Synthetic peptide located within the following region: TAVSIEGVVADTSPQTVAPSSQDTSGQQQQIAVDTSNEHAPAYSYQQSKP
Target Reference Penkov,D., Gene 243 (1-2), 27-36 (2000)
Description of Target RBMS3 is a member of a small family of proteins which bind single stranded DNA/RNA. These proteins are characterized by the presence of two sets of ribonucleoprotein consensus sequence (RNP-CS) that contain conserved motifs, RNP1 and RNP2, originally described in RNA binding proteins, and required for DNA binding. These proteins have been implicated in such diverse functions as DNA replication, gene transcription, cell cycle progression and apoptosis.The protein encoded by this gene is a member of a small family of proteins which bind single stranded DNA/RNA. These proteins are characterized by the presence of two sets of ribonucleoprotein consensus sequence (RNP-CS) that contain conserved motifs, RNP1 and RNP2, originally described in RNA binding proteins, and required for DNA binding. These proteins have been implicated in such diverse functions as DNA replication, gene transcription, cell cycle progression and apoptosis. The encoded protein was isolated by virtue of its binding to an upstream element of the alpha2(I) collagen promoter. The observation that this protein localizes mostly in the cytoplasm suggests that it may be involved in a cytoplasmic function such as controlling RNA metabolism, rather than transcription. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-RBMS3 (ARP40235_T100) antibody is Catalog # AAP40235 (Previous Catalog # AAPS02805)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human RBMS3
Complete computational species homology data Anti-RBMS3 (ARP40235_T100)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express RBMS3.
Swissprot Id Q6XE24-3
Protein Name RNA-binding motif, single-stranded-interacting protein 3
Protein Accession # NP_001003792
Purification Protein A purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express RBMS3.
Nucleotide Accession # NM_001003792
Replacement Item This antibody may replace item sc-103141 from Santa Cruz Biotechnology.
Conjugation Options

ARP40235_T100-FITC Conjugated

ARP40235_T100-HRP Conjugated

ARP40235_T100-Biotin Conjugated

CB Replacement sc-103141; sc-103142
Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 79%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 79%; Rabbit: 100%; Rat: 93%
Image 1
Human HepG2
WB Suggested Anti-RBMS3 Antibody Titration: 2.5ug/ml
Positive Control: HepG2 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com