| Product Number |
ARP40234_T100 |
| Product Page |
www.avivasysbio.com/rbms3-antibody-n-terminal-region-arp40234-t100.html |
| Name |
RBMS3 Antibody - N-terminal region (ARP40234_T100) |
| Protein Size (# AA) |
419 amino acids |
| Molecular Weight |
46kDa |
| NCBI Gene Id |
27303 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
RNA binding motif, single stranded interacting protein 3 |
| Peptide Sequence |
Synthetic peptide located within the following region: GVQAQMAKQQEQDPTNLYISNLPISMDEQELENMLKPFGHVISTRILRDA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Penkov,D., Gene 243 (1-2), 27-36 (2000) |
| Description of Target |
RBMS3 is a member of a small family of proteins which bind single stranded DNA/RNA. These proteins are characterized by the presence of two sets of ribonucleoprotein consensus sequence (RNP-CS) that contain conserved motifs, RNP1 and RNP2, originally described in RNA binding proteins, and required for DNA binding. These proteins have been implicated in such diverse functions as DNA replication, gene transcription, cell cycle progression and apoptosis.The protein encoded by this gene is a member of a small family of proteins which bind single stranded DNA/RNA. These proteins are characterized by the presence of two sets of ribonucleoprotein consensus sequence (RNP-CS) that contain conserved motifs, RNP1 and RNP2, originally described in RNA binding proteins, and required for DNA binding. These proteins have been implicated in such diverse functions as DNA replication, gene transcription, cell cycle progression and apoptosis. The encoded protein was isolated by virtue of its binding to an upstream element of the alpha2(I) collagen promoter. The observation that this protein localizes mostly in the cytoplasm suggests that it may be involved in a cytoplasmic function such as controlling RNA metabolism, rather than transcription. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-RBMS3 (ARP40234_T100) antibody |
| Blocking Peptide |
For anti-RBMS3 (ARP40234_T100) antibody is Catalog # AAP40234 (Previous Catalog # AAPS02804) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human RBMS3 |
| Uniprot ID |
Q6XE24-3 |
| Protein Name |
RNA-binding motif, single-stranded-interacting protein 3 |
| Protein Accession # |
NP_001003792 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_001003792 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
RBMS3 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
| Image 1 | Human HepG2
 | WB Suggested Anti-RBMS3 Antibody Titration: 1.25ug/ml
Positive Control: HepG2 cell lysate |
|
|
