RPL32 Antibody - N-terminal region (ARP40219_T100)

Data Sheet
 
Product Number ARP40219_T100
Product Page www.avivasysbio.com/rpl32-antibody-n-terminal-region-arp40219-t100.html
Name RPL32 Antibody - N-terminal region (ARP40219_T100)
Protein Size (# AA) 135 amino acids
Molecular Weight 15kDa
NCBI Gene Id 6161
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Ribosomal protein L32
Alias Symbols L32, PP9932
Peptide Sequence Synthetic peptide located within the following region: AALRPLVKPKIVKKRTKKFIRHQSDRYVKIKRNWRKPRGIDNRVRRRFKG
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Dias (2000) Proc. Natl. Acad. Sci. U.S.A. 97 (7), 3491-3496
Description of Target RPL32 is a ribosomal protein that is a component of the 60S subunit. RPL32 belongs to the L32E family of ribosomal proteins. It is located in the cytoplasm. Although some studies have mapped this gene to 3q13.3-q21, it is believed to map to 3p25-p24. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L32E family of ribosomal proteins. It is located in the cytoplasm. Although some studies have mapped this gene to 3q13.3-q21, it is believed to map to 3p25-p24. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. Alternatively spliced transcript variants encoding the same protein have been observed for this gene.
Protein Interactions UBC; RNF2; rev; FBXO6; TARDBP; PAN2; UBL4A; NACA2; RPLP0P6; RPS6; RPS4X; RPS3A; RPS3; RPS2; RPL29; RPL23A; RPL21; RPL19; RPL18A; RPL18; RPL17; RPL15; RPL12; RPL9; RPL8; RPL7A; RPL7; RPL5; RPL4; RPL3; RPL10A; MTHFD1; RPSA; ILF3; HSP90AB1; HSP90AA1; CDH2; C
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-RPL32 (ARP40219_T100) antibody
Blocking Peptide For anti-RPL32 (ARP40219_T100) antibody is Catalog # AAP40219 (Previous Catalog # AAPP22063)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human RPL32
Uniprot ID P62910
Protein Name 60S ribosomal protein L32
Publications

Mobine, H. R. et al. Encapsulated pheochromocytoma cells secrete potent noncatecholamine factors. Tissue Eng. Part A 15, 1719-28 (2009). 19125641

Protein Accession # NP_000985
Purification Protein A purified
Nucleotide Accession # NM_000994
Tested Species Reactivity Human
Gene Symbol RPL32
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 93%
Image 1
Human HepG2
WB Suggested Anti-RPL32 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com