KRT18 Antibody - C-terminal region (ARP40206_T100)

Data Sheet
 
Product Number ARP40206_T100
Product Page www.avivasysbio.com/krt18-antibody-c-terminal-region-arp40206-t100.html
Name KRT18 Antibody - C-terminal region (ARP40206_T100)
Protein Size (# AA) 430 amino acids
Molecular Weight 47kDa
NCBI Gene Id 3875
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Keratin 18
Alias Symbols K18, CK-18, CYK18
Peptide Sequence Synthetic peptide located within the following region: ALLNIKVKLEAEIATYRRLLEDGEDFNLGDALDSSNSMQTIQKTTTRRIV
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Ku,N.O., (2005) Gastroenterology 129 (3), 885-893
Description of Target KRT18 (Keratin 18) is type I intermediate filament chain. Keratin 18, together with its filament partner keratin 8, are perhaps the most commonly found members of the intermediate filament gene family. They are expressed in single layer epithelial tissues of the body. Mutations in this gene have been linked to cryptogenic cirrhosis.KRT18 encodes the type I intermediate filament chain keratin 18. Keratin 18, together with its filament partner keratin 8, are perhaps the most commonly found members of the intermediate filament gene family. They are expressed in single layer epithelial tissues of the body. Mutations in this gene have been linked to cryptogenic cirrhosis. Two transcript variants encoding the same protein have been found for this gene.
Protein Interactions KRT18; GOLGA2; UBC; HAUS1; CCDC146; MDM2; EED; HNRNPU; FLII; FKBP3; DDX1; C14orf166; RTCB; CNOT1; SEC16A; RPL14; RFC2; UPF2; BBS7; PAN2; BBS4; BBS2; BBS1; SMARCD1; ORC5; NOS2; KRT8; KPNA2; ITGA4; HRAS; GRN; FN1; EP300; ATF2; CDH1; CDC5L; YTHDC1; PIAS4; TX
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-KRT18 (ARP40206_T100) antibody
Blocking Peptide For anti-KRT18 (ARP40206_T100) antibody is Catalog # AAP40206 (Previous Catalog # AAPP22050)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human KRT18
Uniprot ID P05783
Protein Name Keratin, type I cytoskeletal 18
Sample Type Confirmation

KRT18 is supported by BioGPS gene expression data to be expressed in HepG2

Protein Accession # NP_000215
Purification Protein A purified
Nucleotide Accession # NM_000224
Tested Species Reactivity Human
Gene Symbol KRT18
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 86%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 86%; Rabbit: 77%; Rat: 100%; Zebrafish: 83%
Image 1
Human Lung
Rabbit Anti-KRT18 Antibody
Catalog Number: ARP40206
Paraffin Embedded Tissue: Human Lung
Cellular Data: Alveolar cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
Image 2
Human HepG2
WB Suggested Anti-KRT18 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysateKRT18 is supported by BioGPS gene expression data to be expressed in HepG2
Image 3
Human HepG2
WB Suggested Anti-KRT18 antibody Titration: 1 ug/mL
Sample Type: Human HepG2
Image 4
Human Hela
WB Suggested Anti-KRT18 antibody Titration: 1 ug/mL
Sample Type: Human Hela
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com