| Product Number |
ARP40182_P050 |
| Product Page |
www.avivasysbio.com/homer1-antibody-n-terminal-region-arp40182-p050.html |
| Name |
HOMER1 Antibody - N-terminal region (ARP40182_P050) |
| Protein Size (# AA) |
354 amino acids |
| Molecular Weight |
39kDa |
| NCBI Gene Id |
9456 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Homer homolog 1 (Drosophila) |
| Alias Symbols |
HOMER, SYN47, Ves-1, HOMER1A, HOMER1B, HOMER1C |
| Peptide Sequence |
Synthetic peptide located within the following region: EKFQEFKEAARLAKEKSQEKMELTSTPSQESAGGDLQSPLTPESINGTDD |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Dahl,J.P., (2005) Psychiatr. Genet. 15 (4), 277-283 |
| Description of Target |
HOMER1 is a member of the homer family of dendritic proteins. Members of this family regulate group 1 metabotrophic glutamate receptor function.This gene encodes a member of the homer family of dendritic proteins. Members of this family regulate group 1 metabotrophic glutamate receptor function.This gene encodes a member of the homer family of dendritic proteins. Members of this family regulate group 1 metabotrophic glutamate receptor function. |
| Protein Interactions |
C19orf57; C1orf116; HOMER3; UBC; Cdc16; Snw1; ABI3; AGAP2; SHANK1; GRM1; GRM5; FAT1; EFNB2; RYR2; RYR1; ITPR1; GRIA1; GRIK1; TANC1; DNM3; TRPC1; HOMER1; STX12; PARK2; TRPC5; TRPC2; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-HOMER1 (ARP40182_P050) antibody |
| Blocking Peptide |
For anti-HOMER1 (ARP40182_P050) antibody is Catalog # AAP40182 (Previous Catalog # AAPP22028) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human HOMER1 |
| Uniprot ID |
Q86YM7 |
| Protein Name |
Homer protein homolog 1 |
| Protein Accession # |
NP_004263 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_004272 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
HOMER1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Mouse Brain
 | Host: Mouse
Target Name: HOMER1
Sample Tissue: Mouse Brain
Antibody Dilution: 1ug/ml |
|
| Image 2 | Mouse Brain
 | Host: Rabbit
Target Name: HOMER1
Sample Tissue: Mouse Brain
Antibody Dilution: 1ug/ml |
|
| Image 3 | Transfected 293T
 | WB Suggested Anti-HOMER1 Antibody Titration: 0.0156ug/ml
ELISA Titer: 1:62500
Positive Control: Transfected 293T |
|
